KEGG   Gloeobacter kilaueensis: GKIL_1204Help
Entry
GKIL_1204         CDS       T02885                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
glj  Gloeobacter kilaueensis
Brite
KEGG Orthology (KO) [BR:glj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GKIL_1204
Enzymes [BR:glj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     GKIL_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AGY57450
UniProt: U5QIG8
Position
1228320..1229132
Genome map
AA seq 270 aa AA seqDB search
MIELHCHTTCSDGTLTPGELVAAAAGAGIQALAITDHDTLTGWDEARLACAQYGLELVPG
VELSTLHNGCSLHVLGFYPDQAKLTPFLEERHAARVRRARSTVERLADLGYPIEMPRAST
PGRFHIARALKEAGYIKDEQQAFQRWIGEGKPAYVPYEHLSAAEGIERLRECGAVTVWAH
PMLFRGGNVEAVLPVLVAAGLQGLEVYHCEHTPRQSARLEVLCREWSLIATGGSDFHGDN
KDGVSLNMLRLPLSLLEPLKRLANLPTAIA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaactgcactgtcacaccacctgttctgacggcacgctgacgccgggcgaactg
gtggcggcggcggcgggagccggtattcaggcccttgcaattaccgatcacgacaccctc
acaggttgggacgaggcgcgtcttgcctgcgcgcagtacggcctcgaactggtgccgggg
gtcgaactgagcactctgcacaacggctgttccctgcacgtcctcggtttttatccggat
caagcgaaactgactccttttcttgaggagcgccacgccgcccgcgtgcgccgggcgcgc
agcaccgtcgagcgccttgcggatctgggctatcccatcgagatgccccgcgcctcgacg
ccgggccgctttcacatcgcccgcgccctcaaggaagccggttatatcaaagacgaacag
caagcctttcagcgctggatcggcgagggcaaacccgcctacgttccctacgagcacctg
agcgctgccgagggtatcgagcggctgcgggagtgcggcgctgtcaccgtctgggcgcac
ccgatgctctttcgcggcggcaatgtcgaggccgtacttcctgtcctcgtcgccgccggg
ctgcagggtctcgaagtctaccactgcgagcacaccccccgccagagtgcccgcctcgag
gtcctctgccgcgagtggagcctcatcgctaccggcggcagtgactttcacggcgacaac
aaagatggcgtcagcctcaacatgctccgccttcccctcagcctgctcgaaccgctcaag
cgcctcgccaacctccccaccgccattgcatga

DBGET integrated database retrieval system