KEGG   Gloeobacter kilaueensis: GKIL_3541Help
Entry
GKIL_3541         CDS       T02885                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
glj  Gloeobacter kilaueensis
Pathway
glj00860  Porphyrin and chlorophyll metabolism
glj01100  Metabolic pathways
glj01110  Biosynthesis of secondary metabolites
Module
glj_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GKIL_3541 (hemY)
Enzymes [BR:glj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GKIL_3541 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     GKIL_3541 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 FAD_oxidored FAD_binding_3 HI0933_like Pyr_redox_2 Lycopene_cycl GIDA Pyr_redox Thi4 MCRA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGY59787
UniProt: U5QLC1
Position
3718041..3719450
Genome map
AA seq 469 aa AA seqDB search
MGRMSVAAEPLDVLVVGAGLSGLALAWHLQRSGRRVLVCEATERVGGAISSELIDGFTCE
GGPNSFQSTRPLQELLVELQLEERLVFAEERLARFVWWENRLRPVPMSPAQFVRADLLSW
PGKLRCLSEFFVPPLSEPREETVAEFVLRRFGDEALNRLIEPFIAGVFAGDAGQLSADAA
LAPLVELERQAGSVLRGLWQRRNRGVLTPQRLCTLRGGIEQLPRAIARRLQSQLRFQSRL
EALEPLAGGWQAIVLDGRGEAQAISARSVALAAPAWAIAPVLARLDPSLGRALESIYYPP
VAAVSLGYSKSQLPNLSEGFGHLIPRGQSLRSLGVIYNSCLFRHAAPTSWRLFTCFLGGT
TDPLIADLSDGELANLAHRELQAVLDFQSSYQLLRVARWPRAIPQYALGHITKQERIERY
LAELPGLFLVGNYFGGISVGDCVRQARLKADSVLQFLTRTAANGRLNLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggatgagcgtagccgcagagccgctggatgtactggtagtcggtgccggcctg
agtggtctggccctggcctggcacctccagcgctctggccggagggtcctggtgtgcgag
gcgactgagcgggtgggcggtgcgatcagctccgaactcatcgatggcttcacctgcgag
ggcggtccgaacagttttcaatcgacccggcccctgcaggagttgctggtcgaactgcag
ctggaggagcggctggtctttgccgaggagcggctcgcccgctttgtctggtgggaaaac
cgcctgcggcccgtgccgatgagccctgcgcagttcgtgcgcgcagatctgctcagctgg
ccgggcaaactgcgctgtctatcggaattttttgtgccgcctctttcggagccgcgcgag
gagacggtagccgaattcgtgctgcgccgcttcggcgacgaagcgctcaatcgcctcatc
gaaccgttcatcgccggggtgttcgcaggcgacgccgggcagttgagcgccgatgcggcc
ctcgccccgctcgtcgaactggaacgccaggcgggcagcgtgctcagggggctgtggcag
cgccgcaatcggggggtgctcacaccccagcggctgtgtacgctgcgcggcggcatcgag
cagttgccacgggcaattgcccggcggttgcaatcgcagttgcgcttccaatcgcgctta
gaggcgctggaaccgctggcagggggctggcaggcgattgtcctcgatgggcggggtgag
gcccaggcgatcagtgcccgctcggtggcgcttgccgcccccgcttgggcgatcgctccg
gtgctggcgcggctcgatccgagcctgggccgcgccctggagagcatctactatccaccg
gtggcggcggtcagcctcggctactcaaaaagccagcttcccaacctgagcgaaggcttc
ggccatctcatcccgcgcggacaatcgctgcgcagcctcggggtgatctacaacagttgc
ctcttccggcacgccgccccgacgagctggcggctttttacctgttttttagggggtacg
accgacccgctcatcgccgatctgagcgacggtgaactggccaatctggcgcaccgcgaa
ctgcaggcggtcctcgactttcaatcgagctatcagctgttgcgggtggcgcgctggccc
agagcgattccccagtatgccctgggccatatcaccaaacaggagcgcatcgagcgctac
ttggcggagctgccgggattgtttctggtcggcaattattttggcggcatctctgtgggc
gactgcgtgcgccaggcccgtctcaaggcagatagcgtgctgcagtttctcacaagaacc
gctgccaatggccgcctcaacctggcctga

DBGET integrated database retrieval system