KEGG   Geobacter lovleyi: Glov_0244Help
Entry
Glov_0244         CDS       T00708                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
glo  Geobacter lovleyi
Pathway
glo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:glo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Glov_0244
Enzymes [BR:glo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Glov_0244
DNA repair and recombination proteins [BR:glo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Glov_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 Helicase_RecD AAA_11 PIF1 T2SSE AAA_28 HHH_2 NTPase_1 UvrD-helicase AAA_16 PhoH HHH AAA AAA_29 cobW AAA_22 DUF2075 NACHT AAA_5 RsgA_GTPase ABC_tran TrwB_AAD_bind Mg_chelatase MobB AAA_24 Herpes_Helicase AAA_14 UvrD_C CbiA AAA_33 TsaE
Motif
Other DBs
NCBI-ProteinID: ACD93973
UniProt: B3EAY9
Position
222020..224206
Genome map
AA seq 728 aa AA seqDB search
MNGKGTTSDVPVERISGSVERVTFHSEESGFCVLRIKVKGKRELVTVIGSAATITPGEFV
ECVGTWHNDKTHGLQFKTTHLKTVPPSTLEGIEKYLGSGMVKGIGPHFAKVLVKAFGVDV
FTVIEETPEKMLSLPGIGKKRTDKVTAAWAEQKAIREIMVFLQSHGVGTGRAVRIYKTYG
DEAIIKVSENPYRLALDIHGIGFKTADVIADRLGIAPDSLIRAQAGVRHVLQELSGDGHC
AATHDTLIKESVKLLEIDEAILEEAIREEVTQENLVPEEIDDVPCLFLSALHRAELGVAN
SVRRILSGEPPWGKIDMEKALPWVEEKTGLSLSQSQQDAVCLALTSKALVITGGPGTGKT
TLVNSILKILAAKQLEILLAAPTGRAAKRMTETTGREAKTIHRLLEFDPQSFGFKRGRDN
PLEADLIVIDESSMVDVVLMNKLLAAVPESTALMIVGDVNQLPSVGPGAVLADIITSGSV
PTVRLTEIFRQAATSKIIVNAHRINKGELPLRNETEELSDFYFIPAETPEEIHAKLLQVV
TERIPKRFGLHPVKDVQVLTPMNRGGLGAHALNAELQKVLNGNSEPKITRFGTTYSPGDK
IIQTVNNYDKEVFNGDIGQILEIDTEESSLKADYDGRIVEYEFGELDEVSLAYATSIHKS
QGSEYPAVVIPLAMQHYMLLERNLIYTAVTRGKKLVTIIGQPKALGMAVKNKNATKRLTN
LTARLRSA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggaaaggcaccacttcagatgtcccggtcgaacggatttccggttccgtcgag
agggtaaccttccacagcgaggaatcaggtttctgtgtgctccggatcaaggtaaaaggt
aagcgcgagttggtcacggtcatcggcagtgcggcaacgataaccccaggtgaattcgtc
gagtgtgttggtacctggcataacgacaagacccacggcctgcagttcaagactactcac
ctgaaaacagtccccccgagtaccctggaaggcatcgaaaagtaccttggctccggcatg
gtcaaagggatcggcccccatttcgccaaagtactggtgaaggcattcggcgtcgacgtc
ttcaccgttatcgaggaaaccccggagaaaatgctgtcactccccggcattggcaagaaa
aggacggataaagttaccgctgcctgggcagagcagaaagcgatccgggagatcatggtt
ttcctccagtcccatggtgtcgggaccggtcgggcggtcaggatctacaaaacttatggc
gatgaggccatcatcaaggtgtctgagaacccctaccgcttggctctcgacattcacgga
atcggtttcaagaccgctgacgtcattgccgacaggctgggtattgccccggactcactg
atccgggctcaggccggcgtgcgccatgtattgcaggagttgtccggcgacggccattgt
gccgccacccacgacaccctcatcaaggagtcggtaaagcttctggagattgacgaggca
atcctggaagaagcgatccgggaggaagtcacccaggaaaacctggtgccggaagaaatc
gacgacgttccctgtctgtttctgtccgcgcttcaccgggctgaactgggagtggcgaac
agcgtcaggagaatactgagtggagagccgccatggggcaaaatcgatatggaaaaggcg
ctcccctgggtggaagagaagacgggcctttcactctcccagtcgcagcaggacgctgta
tgccttgctttaaccagcaaagcactcgtcatcaccggcggcccgggcaccggcaagacg
accctggtcaatagcatcctgaagatcctcgcagccaaacagctcgaaatcctgttggcc
gccccgaccggacgcgcggccaagcggatgaccgagactacaggacgggaggccaagacc
attcatcgcctcctggagtttgatccccagagtttcggtttcaaacgcgggcgagacaac
cctctcgaagcagacctcatagtcattgacgaatcatctatggtggatgtggtgctgatg
aacaagctcctcgcggcagtccccgaaagcaccgctctgatgattgttggcgatgtaaat
cagctgccttcagtcggtcccggtgcggtgctggccgacatcatcacatccggttctgtc
ccgaccgtcaggctgaccgagattttccgccaggcagccacctcaaagatcatcgtcaat
gcccaccggatcaacaagggagagttgccgctgagaaatgaaacggaagagctatccgac
ttctacttcataccggcagaaactccggaagaaattcacgccaagctactgcaggtggtt
accgaacgcattccgaagcgcttcggcctgcatccggtcaaggatgtccaggttctcacc
ccgatgaaccggggaggactgggcgctcacgccttgaacgcggaactccagaaagtgctc
aatgggaacagcgagcccaaaataacccgctttggaacgacgtactcgccgggtgacaag
atcatccagacggtgaataactacgacaaggaagtcttcaacggggatattggccagatt
cttgaaatcgataccgaggaaagctccctcaaagctgattacgacggtagaatagtcgag
tatgaatttggtgaactggacgaggtgtcgctggcctatgccaccagcatccataagagc
cagggttcagagtacccagctgtcgtgattccactggcaatgcagcattacatgctgctg
gagaggaatctgatctatacggccgtcacgcgggggaaaaaactggtgacgatcatcggc
cagcccaaggcattgggtatggcggtgaagaataaaaatgccacaaagcgtttgacgaat
ttgacagcgaggctgcgttccgcatga

DBGET integrated database retrieval system