KEGG   Geobacter lovleyi: Glov_0318Help
Entry
Glov_0318         CDS       T00708                                 

Definition
(GenBank) TraB pilus assembly family protein
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
glo  Geobacter lovleyi
Brite
KEGG Orthology (KO) [BR:glo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:glo02044]
    Glov_0318
Secretion system [BR:glo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Glov_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI DUF1198
Motif
Other DBs
NCBI-ProteinID: ACD94046
UniProt: B3EB62
Position
complement(294394..295662)
Genome map
AA seq 422 aa AA seqDB search
MKNKLLSFWNGLSGSQRRNLVWIMTGCILVAVFTIGYYVMNKGKDPALNKSVKQTPLSIE
PKLLEKSQFLESQKEIAKRDDKVAELTKKLDEITREKKGDPTTAPVAQIGTAPAVPGDNH
AQQQGQLQKTGSGRTAISKQPLPPIPPMPQGSSISLPPPPATAQGIAAGQLQSPTETEIG
DIAIVSSPGSGKSAKADVDDKKKDVGTVQVYLPPSFMEATLLSGLDAPTTSEAKGNPVPV
LLRVKTPAVLPNSVKANLKGCFVIADGKGNLATERAELLLVSLSCLDRKGQAVVDQKIKG
FVVDEDGKIGLRGRVVAKMGSMIARSMLAGFFGGAGDAIKSAATTMSVSPLGTTQTVDPK
DIAMSGLGSGLSSGFKEIQKFYMELARQTMPVIEVGATKPVTLVISEGINLDIKKIAKGG
GK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataagctcctgtctttctggaacgggctaagtggcagtcagcgccgaaatctt
gtctggattatgactggctgcattctggtggcagtatttacgattggctattacgtcatg
aacaaagggaaagatcctgctctcaataaaagtgtgaagcagacgcccttgagcatcgag
ccaaaactccttgaaaagtcacaattccttgaaagccagaaggaaattgccaagcgtgac
gacaaggttgccgaactcacgaagaaactcgatgagatcacccgtgagaaaaagggtgat
ccgactacagcgccggtggctcagatcggcacagcccccgctgtaccgggagacaatcat
gctcagcagcagggccaattgcaaaaaaccggttctggcaggacagcaatatcaaaacaa
ccgttgcctccaattccaccgatgccgcaaggcagcagcatctcgcttccccctccgcct
gccacagctcaaggaattgcagcaggtcagctgcagtctccaaccgaaacggaaatcggc
gatatcgccatcgtttcgtctcccggatcaggtaaatcagccaaggctgatgtggatgat
aaaaaaaaagacgtcgggaccgtccaggtttatctgcccccttcctttatggaggcgact
ctgttgagtggcttggacgctccaaccacttcggaagccaaaggaaatccggttccggtg
ctgctcagggtaaagactccagcggtactgcccaatagcgtcaaggcaaacctcaaaggg
tgctttgttatcgccgacggcaaggggaacctggcaaccgagcgtgcggaactgctgctc
gtttccctgtcatgcctcgaccgtaaggggcaggcggtggtcgaccagaagatcaaaggg
ttcgtcgttgatgaagacggcaaaattggcctgcgtggccgggtcgttgccaagatgggc
tctatgatcgccaggagcatgttggccggtttcttcggcggtgccggtgacgcgattaag
tctgcggccacgaccatgtccgtaagccctctcggtacaacacaaaccgttgaccccaaa
gacattgccatgtctgggcttgggtccggcctgtcgagtggcttcaaagagatccagaag
ttctacatggaactggctaggcaaaccatgccggtcatagaagtcggagccacaaagcct
gtgacactggtcatcagcgaaggaatcaatctggacatcaagaaaattgccaagggaggc
ggaaagtga

DBGET integrated database retrieval system