KEGG   Geobacter lovleyi: Glov_3003Help
Entry
Glov_3003         CDS       T00708                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
glo  Geobacter lovleyi
Pathway
glo00010  Glycolysis / Gluconeogenesis
glo00071  Fatty acid degradation
glo00350  Tyrosine metabolism
glo00625  Chloroalkane and chloroalkene degradation
glo00626  Naphthalene degradation
glo01100  Metabolic pathways
glo01110  Biosynthesis of secondary metabolites
glo01120  Microbial metabolism in diverse environments
glo01130  Biosynthesis of antibiotics
glo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glov_3003
  Lipid metabolism
   00071 Fatty acid degradation
    Glov_3003
  Amino acid metabolism
   00350 Tyrosine metabolism
    Glov_3003
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Glov_3003
   00626 Naphthalene degradation
    Glov_3003
Enzymes [BR:glo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Glov_3003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACD96709
UniProt: B3E8N3
Position
complement(3219610..3220653)
Genome map
AA seq 347 aa AA seqDB search
MLPELAPKMLAMVLSRPGAPLELRELDVPQPGAGQLLLEVTACGICRTDLHIVDGELTEP
QLPLVPGHQIVGRVARCGAGVNGGVISQRVGVPWLGGTCGSCRYCLGGQENLCDHAVFTG
YQINGGFAGYCLADARFCFPLPDGYPDLQVAPLLCAGLIGYRSLRMAGEGRQLGIYGFGA
AAHIVTQVAVWQGRQVYAFTRPGDLAGQAFARRMGACWAGGSFDRPPQELDSAIIFAPAG
ELVPAALQAVRKGGRVVCGGIHMSAIPSFSYDLLWGERSLVSVANLTRQDGEEFLALAPQ
VPVRTEVTAFRLEQANEALAALRSGQLEGAGVLLVDEQIRKRGARGD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgagctggcgccgaaaatgctggccatggtcttgagccggccgggtgccccc
cttgagttgcgggagcttgacgtgccgcagccgggtgccggacagctgctgctggaggtg
acggcatgcggcatctgccgcacggatctgcatattgtggacggcgaattgacagagccg
cagctgccgttggtgccggggcatcagattgttggcagggtggcccgttgcggggccggg
gtaaacggaggggtcattagccagcgggtcggtgttccctggctggggggaacctgcgga
agctgccgttattgtctgggcggtcaggaaaatctgtgcgatcatgccgtgtttaccggc
taccagatcaacggcgggtttgccgggtactgccttgctgacgcacggttctgtttcccg
ctgccggacggctatcccgatctgcaggtggccccgctcctgtgcgccggactgatcggc
taccgctcgctgcggatggcgggggagggcaggcaactggggatctacggctttggcgca
gcagcgcatattgtgacccaggtggcggtctggcaggggcggcaggtctatgcctttacc
cggcccggggacctggccgggcaggcctttgcccgccggatgggggcctgctgggccggc
ggttcctttgacaggcctccgcaggagctggacagtgccatcatctttgctccggccgga
gagctggtgcctgctgccctgcaggcggtgcgcaaaggcggccgggtggtctgcggcggt
atccatatgagcgccatcccatctttttcctacgatctgctgtggggagaacgttcgctg
gtctcggtggccaacctgacccgccaggatggtgaggagttcctggcactggcgccgcag
gtgccggtccggaccgaagtcacggccttcaggttggaacaggccaacgaggcccttgca
gcgctgcgttcagggcagctggaaggggccggggtattgctggttgatgaacagatcagg
aagaggggagccagaggtgattga

DBGET integrated database retrieval system