KEGG   Geobacter lovleyi: Glov_3084Help
Entry
Glov_3084         CDS       T00708                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
glo  Geobacter lovleyi
Pathway
glo00860  Porphyrin and chlorophyll metabolism
glo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Glov_3084
Enzymes [BR:glo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Glov_3084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACD96790
UniProt: B3E977
Position
3305085..3305687
Genome map
AA seq 200 aa AA seqDB search
MTSMTRLYLIRHGQVQGFEQRRYNGHADVALTDLGVEQYHLLKDRLADSHISACYSSDLT
RCKIGANIICEQFGIEPVHRSELRELNIGIWESLTWQEIQSRWPNEWQARLNDLVNYRVP
EGENLLDVEARAMPVVREMLERHRGQELLLVGHGGLNRIILLNAIGAPLINMFNIEQNYG
CLNIIDYYADGRATVKLLNG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatgacccgcctctacctgatccgccatggtcaggtgcaaggctttgaacag
cgccgctacaacggacacgccgatgttgccctgaccgacctgggggttgaacagtaccat
ctgctgaaggatcgactggctgacagccatatctcggcctgctactccagcgacctgacc
cgctgcaagatcggcgcaaacatcatctgtgaacagttcgggatagagccggtccaccgt
tcagagctgcgcgaactgaatatcggtatctgggaaagcctgacctggcaggagatccag
agccgctggcccaatgaatggcaggcccgcctgaacgacctggtcaactaccgggtgccg
gagggggaaaacctgctggatgtggaggccagggccatgccggtggtacgtgaaatgctg
gaacgccatcgtgggcaggaactgctgttggtgggacacggcggtctgaaccggatcatc
ctcttgaatgccatcggggcaccgctgatcaacatgttcaacattgagcagaactacggc
tgcctgaatatcatcgactactatgccgacggccgggcaacggtcaagttgctgaacggc
taa

DBGET integrated database retrieval system