KEGG   Geobacter lovleyi: Glov_3611Help
Entry
Glov_3611         CDS       T00708                                 

Definition
(GenBank) Nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
glo  Geobacter lovleyi
Pathway
glo00230  Purine metabolism
glo00240  Pyrimidine metabolism
glo01100  Metabolic pathways
glo01110  Biosynthesis of secondary metabolites
glo01130  Biosynthesis of antibiotics
Module
glo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
glo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
glo_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:glo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Glov_3611
   00240 Pyrimidine metabolism
    Glov_3611
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:glo04131]
    Glov_3611
Enzymes [BR:glo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Glov_3611
Membrane trafficking [BR:glo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Glov_3611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ACD97312
UniProt: B3E3P0
Position
complement(3881379..3881795)
Genome map
AA seq 138 aa AA seqDB search
MERTFAIIKPDAVERGLSGKIITKIEEAGFAIVGMKKIHLSRAQAEGFYYVHKERPFFND
LCSFMSRSPVIVMCLQKENAIADWRTLMGATNPANAEPGTIRKEFAKNIEENSSHGSDAP
ETAAFEIPYFFNSFELVG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtacctttgctatcatcaagccggatgccgttgagcggggcctgtccggcaaa
atcatcaccaagattgaagaagccggttttgccatcgtcggcatgaagaaaatccatctt
tcccgtgcccaggctgaaggtttctactatgttcacaaagagcgtccgttcttcaacgac
ctctgcagcttcatgtcccgttcaccggtgatcgtgatgtgcctccagaaagagaatgcc
attgctgactggcggaccctgatgggtgccaccaaccctgccaatgcagagcccggcacc
atccgtaaggagtttgcaaagaatatcgaagagaactcatcccacggctcagacgcgcct
gagaccgcagcctttgagatcccctatttcttcaacagcttcgagctggtgggctaa

DBGET integrated database retrieval system