KEGG   Gloeocapsa sp. PCC 7428: Glo7428_1044Help
Entry
Glo7428_1044      CDS       T02400                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00630  Glyoxylate and dicarboxylate metabolism
glp00710  Carbon fixation in photosynthetic organisms
glp01100  Metabolic pathways
glp01110  Biosynthesis of secondary metabolites
glp01120  Microbial metabolism in diverse environments
glp01130  Biosynthesis of antibiotics
glp01200  Carbon metabolism
Module
glp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
glp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
glp_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:glp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Glo7428_1044
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Glo7428_1044
Enzymes [BR:glp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Glo7428_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFZ29618
UniProt: K9XAV9
Position
1143495..1143842
Genome map
AA seq 115 aa AA seqDB search
MQTLPKERRYETLSYLPPLSDAQITKQIQYILNQGYIPAVEFNESSEPEQHYWTLWKLPL
FGARSTQEVLSEVQACRSEYGNCYIRVVGFDNVKQCQILSFIVHKPNQNSYGGRY
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttacccaaagagcgtcgctacgaaaccctgtcttatctcccacctttaagc
gatgctcaaattacaaaacagatccagtacattctgaaccaaggctacatcccagcagtt
gagttcaacgaatcttctgaaccagaacaacactactggacattgtggaaattgcctttg
tttggtgctagaagtacccaagaagtactcagcgaagttcaagcttgtcgttcagagtat
ggcaattgctatattcgtgtagtaggttttgacaacgttaagcaatgccaaatcctcagt
tttatcgtacataagccaaatcaaaatagctacggcggcagatactaa

DBGET integrated database retrieval system