KEGG   Gloeocapsa sp. PCC 7428: Glo7428_1204Help
Entry
Glo7428_1204      CDS       T02400                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00860  Porphyrin and chlorophyll metabolism
glp01100  Metabolic pathways
glp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Glo7428_1204
Enzymes [BR:glp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Glo7428_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_16 AAA_22 Sigma54_activat AAA_29 DUF815 AAA ABC_tran AAA_18 AAA_28 Hpr_kinase_C AAA_30 AAA_27 AAA_23 MMR_HSR1 RNA_helicase AAA_7
Motif
Other DBs
NCBI-ProteinID: AFZ29777
UniProt: K9XDN2
Position
complement(1327283..1328389)
Genome map
AA seq 368 aa AA seqDB search
MSSTAQATRRVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLL
PEIEVVADDPFNSDPHDPELMSDAVRQQLEQQIEIPVAHKKVPMVDLPLGATEDRVCGTI
DIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAAGGWNTVEREGISI
RHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRAEFDQNPQQFL
EKYQPQQQELQQKLIQAQALLPSVNIDYDLRVNISEVCSELDVDGLRGDIVTNRAAKALA
AFEGRTEVTVDDIRRVITLCLRHRLRKDPLETIDSGYKVEKAFNRVFGIEDTTEAAQSNG
TAQMSGRR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcaactgcccaagctacccgccgcgtttttcccttcactgccattgttggtcag
gaagaaatgaaacttgccttattgttgaacgtgattgaccctaaaattggtggtgtcatg
atcatgggcgatcgcggtactggtaaatcaacaacaattcgggcattagctgatttgctt
ccagaaattgaagttgttgcagatgacccttttaacagcgatccgcacgatcctgaactg
atgagtgacgctgttaggcagcaactcgaacagcaaatcgaaattcctgtcgcgcacaaa
aaggtgccgatggtggatttgcccttgggtgcgaccgaagaccgcgtgtgtggcacgatc
gacattgaaaaagcactctctgaaggcgtcaaagcctttgaaccaggactccttgctaaa
gcaaatcgcggcattctctacgttgatgaagttaacctcctcgacgatcatttagtagac
gtccttctcgactccgcagcaggtggttggaatacggtagaacgcgaaggaatttcgatt
cgtcaccctgcacgttttgttttagtgggttcgggaaaccctgaagaaggtgaactgcgt
ccgcaacttctcgatcgctttggaatgcacgcagaaattcacaccgtcaaagaacctgca
ttacgcgtccaaatcgtcgaacaacgagccgaatttgaccaaaatccgcagcagttctta
gaaaaatatcaaccccagcagcaagaattgcaacaaaaattaattcaagctcaagcactt
ttaccttcagtcaatatcgattacgacctaagagttaatatttcagaagtctgttcagaa
cttgatgttgatggcttgcgcggtgatattgtcacaaaccgtgccgcaaaagctttagcc
gcctttgaaggacgtaccgaagtcaccgttgatgatattcgtcgcgtcattactttgtgt
ctgcgccatcgcttgcgcaaagatcccttggaaacaattgattctggctacaaagtagaa
aaagctttcaatcgcgtatttggaatcgaagataccacggaagcggctcaatcaaacggt
actgctcaaatgagtggacgtcgctaa

DBGET integrated database retrieval system