KEGG   Gloeocapsa sp. PCC 7428: Glo7428_2153Help
Entry
Glo7428_2153      CDS       T02400                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00010  Glycolysis / Gluconeogenesis
glp00071  Fatty acid degradation
glp00350  Tyrosine metabolism
glp00625  Chloroalkane and chloroalkene degradation
glp00626  Naphthalene degradation
glp01100  Metabolic pathways
glp01110  Biosynthesis of secondary metabolites
glp01120  Microbial metabolism in diverse environments
glp01130  Biosynthesis of antibiotics
glp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glo7428_2153
  Lipid metabolism
   00071 Fatty acid degradation
    Glo7428_2153
  Amino acid metabolism
   00350 Tyrosine metabolism
    Glo7428_2153
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Glo7428_2153
   00626 Naphthalene degradation
    Glo7428_2153
Enzymes [BR:glp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Glo7428_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 DZR
Motif
Other DBs
NCBI-ProteinID: AFZ30676
UniProt: K9XF30
Position
complement(2428104..2429099)
Genome map
AA seq 331 aa AA seqDB search
MRAMILETPGKPLRVANLPIPTPNPQQVLIRVRACGICRTDLHIVDGELTQAKLPLVPGH
QIVGIIEAVGEEVVPQFKVGDRVGVPWLGYTCDHCRYCLSGKENLCDYAQFTGYQIDGGY
AEYTVADARFCFPIPADYPDLQAAPLLCAGLIGYRAYRMTGDAHKLGFYGFGAAAHILIQ
LARHQGREVYAFTREGDIAGQEFARQLGAVWAGGSAELPPEPLDAAIIFAPIGALVPAAL
RAVAKGGVVVCAGIHMSDIPSFPYHILWEERVVRSVANLTRLDGEEFLTLAPQVPIHTEV
NVFPLNEANDALDALRSGKINGAAVLVVAHD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcaatgattctagagacaccaggaaaacccctgcgtgttgctaacttaccaatt
cctacacccaatccgcagcaagtcttaattcgcgttcgcgcctgcgggatttgtcgcaca
gatctacacattgttgacggagaactcacacaagcgaaactacccttagttcctggacat
caaatagtaggaattattgaagcagtcggagaagaagtagtaccgcaatttaaagtagga
gatcgcgttggtgttccttggttagggtatacgtgcgatcattgccgctattgtttgagt
gggaaagaaaatctttgtgattatgcgcagttcactggctatcaaatcgatggtggttat
gctgaatacaccgttgctgacgctaggttttgttttccgattcctgcggactacccagat
ttacaagcagcgcctttattgtgtgcaggattgattggttatcgcgcttatcgcatgaca
ggtgatgctcacaagttaggtttttacggctttggtgctgctgcacatattctgattcaa
ctcgcacgccatcaaggacgagaagtttatgcttttactcgcgagggagatattgcagga
caagaatttgcgcgtcagcttggtgcggtgtgggctggtggttcagcagaattaccacct
gaacctttagatgcggcaattatctttgcgccaattggtgctttagtccctgctgcactg
cgtgcggttgcgaaagggggtgtcgttgtttgtgctggaattcatatgagtgatattcct
tcgtttccttatcacattttgtgggaagaacgagttgtgcgatcggttgctaatctcacg
cgtcttgatggcgaagagttcttaactctagcaccgcaagttcccatccatactgaagtt
aatgtttttcctttaaatgaggcaaacgatgcactcgatgcgctacgtagtggcaaaatt
aatggcgcagctgtcttagttgtcgcccatgactaa

DBGET integrated database retrieval system