KEGG   Gloeocapsa sp. PCC 7428: Glo7428_2650
Entry
Glo7428_2650      CDS       T02400                                 

Definition
(GenBank) Cytochrome c-550
  KO
K02720  photosystem II cytochrome c550
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:glp00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    Glo7428_2650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:glp00194]
    Glo7428_2650
Photosynthesis proteins [BR:glp00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in cyanobacteria
    Glo7428_2650
SSDB
Motif
Pfam: Cytochrom_C550 Cytochrom_C Cytochrome_CBB3
Other DBs
NCBI-ProteinID: AFZ31151
UniProt: K9XGH8
Position
2963884..2964375
AA seq 163 aa
MFKRLIGLAVATILLTFGVIVGNAAAVELSEAVRTVPLNDQGDTTVLSLKQVQEGKRLFN
FACAQCHAGGVTKTNQNVGLDPETLALATPPRNNIEGLVDYMHNPTTYDGEEEIAELHPS
TKSADIYPAMRNLTEDDLVAIAGHVLLQPKIVGDRWGGGKIYY
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtttaaaagattgatcgggcttgcggtggctactatattgctgacattcggagtgatt
gttggcaatgcagccgcagtggaactaagcgaagctgtacgaacagtaccgctaaatgac
caaggtgataccactgtgctgagcctcaaacaagtccaagaagggaaacgcttatttaac
tttgcttgtgcgcagtgtcatgctggaggtgtcaccaagacaaaccaaaacgtagggtta
gaccccgaaacgcttgctttagcaacaccaccccgcaacaatattgaagggcttgtcgat
tatatgcacaaccccaccacctatgatggtgaagaagaaattgcggagttacacccaagc
accaagagtgcggatatttacccagcaatgcggaatcttaccgaagacgacttagtggcg
atcgcaggtcatgttctgcttcagccaaaaattgttggcgatcgctggggcggcggcaag
atttactactaa

DBGET integrated database retrieval system