KEGG   Gloeocapsa sp. PCC 7428: Glo7428_4485Help
Entry
Glo7428_4485      CDS       T02400                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00860  Porphyrin and chlorophyll metabolism
glp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Glo7428_4485
Enzymes [BR:glp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Glo7428_4485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase SNO GATase_5
Motif
Other DBs
NCBI-ProteinID: AFZ32926
UniProt: K9XLI0
Position
5006338..5007825
Genome map
AA seq 495 aa AA seqDB search
MKAIMVVGTTSHAGKSLLSAAICRILARRGWRVAPFKGQNMALNSYVTTSGGEIGYAQAV
QAWAAGVTPTVDMNPILLKPQGNMTSQVILKGKAVGKVSATDYYEQYFDIGWQAITESLQ
HLAAEFDLLVCEGAGSPAEINLKHRDLTNMRVAKHLNAPTLLVVDIDRGGAFAHVVGTLE
LLEPEERALIRGVVINKFRGQRSLLESGLQWLEERTGIPVLGVIPWIEDVFPAEDSLDLL
ERKHSNQGELEIAVIRLPRISNFTDFDPLEAEPSVSLKYISPKQELGHPDAVIIPGSKTT
IADLLVLQRTGMAEAIQNYAAAGGTVLGICGGFQMLGKFLADPEGVEGEAGRFKGLSLLP
IQTVITGQKVARQRQVVSNFPQVGLPVAGYEIHQGRSRIVETPNTAPNPNTYQALFDDPS
LGLVDNYQSVWGTYLHGIFDNGAWRRAWLNRLRQQRGLKSLPTGVSNYRKQRETMLNTLA
AIVEANLDLTKILPS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattatggtggtaggaaccacatcccacgctggaaaatcgctccttagtgca
gctatttgtcgcattttggcgcgacgtggctggcgggttgcgcccttcaaagggcaaaat
atggctttaaattcctatgtcaccacgagtgggggcgaaattggttatgcacaagccgta
caagcttgggcggcgggcgtcacgccgacagtagacatgaaccccattctgctcaagccg
cagggtaacatgacctcgcaagtcattctcaaaggtaaagctgtaggcaaagtgagcgcg
actgattactacgaacaatattttgatataggatggcaagcaattacagagtcattacaa
cacctcgcggctgaatttgatttgctggtgtgtgaaggtgcaggaagtcccgcagaaatt
aaccttaaacaccgcgatttgacaaatatgcgcgtcgcaaagcatttaaatgctcccacc
ttgctagttgttgatattgatcgtggtggtgcttttgctcatgtggtaggcactttagag
ttactagaaccagaggaaagagcgttaattcgcggtgtcgttatcaataaatttcgcgga
cagcgatcgcttttagaatcaggtcttcaatggttggaagaacgcacggggattcctgta
ttaggtgttattccctggattgaagatgtctttccggctgaagactctttagacttactc
gaacgcaaacacagtaatcaaggagaacttgagattgccgttatccgcttaccccgaatt
tctaactttaccgattttgacccgttagaagccgaaccaagtgtttcgctaaaatacatt
agcccaaagcaagaattggggcatcctgatgcggtgattattccaggttcaaaaacgaca
attgcagacttattagttttgcagcgaactggaatggcagaagcaattcaaaactatgca
gcagccggcggtacggtcttaggaatttgtggtggctttcaaatgctaggcaaattcctc
gccgatcctgaaggcgtagagggcgaagcaggaagatttaagggattaagtttattgcca
attcaaacggtaattacagggcaaaaagtagcgcgacaacggcaagttgtatcaaatttt
ccacaagtaggcttacctgttgctggctacgaaattcatcaagggcgatcgcgtatcgtg
gaaactccgaatacagcacctaatcctaatacataccaagcgttatttgacgatcctagt
ttgggtttggttgataattatcaatcagtttggggaacgtacttgcacggtattttcgac
aatggcgcttggcgacgtgcttggttaaatcgcttacggcaacaacgcggtctaaaatct
ttacctacaggtgtttctaactatcgcaaacagcgcgaaactatgttaaatacgcttgct
gctattgtagaggcaaacttagacttgacgaagattttgccgtcctaa

DBGET integrated database retrieval system