KEGG   Gloeocapsa sp. PCC 7428: Glo7428_4677Help
Entry
Glo7428_4677      CDS       T02400                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00040  Pentose and glucuronate interconversions
glp00052  Galactose metabolism
glp00500  Starch and sucrose metabolism
glp00520  Amino sugar and nucleotide sugar metabolism
glp01100  Metabolic pathways
glp01130  Biosynthesis of antibiotics
Module
glp_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Glo7428_4677
   00052 Galactose metabolism
    Glo7428_4677
   00500 Starch and sucrose metabolism
    Glo7428_4677
   00520 Amino sugar and nucleotide sugar metabolism
    Glo7428_4677
Enzymes [BR:glp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Glo7428_4677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFZ33110
UniProt: K9XKG3
Position
complement(5213860..5214741)
Genome map
AA seq 293 aa AA seqDB search
MKIRKAVIPAAGFGTRLFPATKAIKKELFPIIDKDGRAKPVIQIIVEEAISAGIEEIGII
VQTSDRLLFEDFFKSPPKPELLQKLSPQNQEYSQYLQDLGSKVTILTQDTQEGYGHAVFC
ARDWVNNEPFLLMLGDHIYASDTENSCTAQVLEIYNLVNQNTIGLTTMPAEIIYKAGCVT
GTWQQNSLLNLTQVYEKPSIEYARQYLRVERIPEDEFLCIFGLYALSPKLFDFLEEHIKN
NIRDRGEFQLTSALESLRQVEGMTGYIVKGRCFDTGMPDAYLQTMIDFRGKHS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgtaaagcggtaattcccgcagcagggttcggtactcgtttattcccagca
accaaagctattaaaaaagaactctttccgattatcgacaaagatggaagagcaaaacct
gttattcaaataattgtggaagaagcaattagcgcgggaattgaagaaattggtatcatc
gtacaaacaagcgatcgcctactctttgaagacttttttaaatcaccacccaaaccagaa
cttctccaaaaattatcaccacaaaatcaagaatatagccaatatctccaagatttaggt
agcaaagttacaatcttgacacaagatacacaagaaggctacggtcatgcggtattctgt
gccagagattgggtaaataacgaaccttttctattaatgctaggcgatcatatttacgct
tctgatactgaaaactcatgtactgcacaagttttagaaatttataacctagttaatcaa
aatacaattggattaacaacaatgccagcagaaataatttataaagctggttgcgttaca
ggtacttggcaacaaaattcactgcttaatctgacgcaagtctacgagaaaccatcgatt
gaatatgcgcgtcaatatttacgtgtagagcgaatacctgaagatgaatttttgtgtata
tttggcttatacgcactatcgccaaaactatttgattttctagaagaacatattaagaat
aatatccgcgatcgcggcgaatttcaattaacatctgcgctagaaagcttacgtcaagtg
gaaggaatgacgggctacattgttaagggacgttgttttgatacaggaatgcccgatgct
tatctccaaacaatgattgattttagaggaaagcattcttaa

DBGET integrated database retrieval system