KEGG   Glarea lozoyensis: GLAREA_00044Help
Entry
GLAREA_00044      CDS       T04883                                 

Definition
(RefSeq) Metallo-dependent hydrolase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
glz  Glarea lozoyensis
Pathway
glz00520  Amino sugar and nucleotide sugar metabolism
glz01100  Metabolic pathways
glz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GLAREA_00044
Enzymes [BR:glz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     GLAREA_00044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 19459104
NCBI-ProteinID: XP_008082995
UniProt: S3DA94
Position
Unknown
AA seq 434 aa AA seqDB search
MPSAITTGRPTITKFTNCRLLKGDQLVNQDLWVSSSTGKIVRSQEAFYSEHSVPDITINL
NGRIISPGLIDVQLNGAFGFNFSSIPEDPSTYGKLLRQVNKSLVQTGVTSYLPTLTSSNK
DVYHQALPHLGPSGRYRVASDGAESLGAHCEGPFISPTKNGIHPVEVLVPAPNGFSDLED
IYGVENISSTIDRDGNIAPPRIRKITAAPEIAAMTNTIQEITSRGIVYSIGHTEATYEEA
SAAVAAGATMITHLFNAMRPLHHRNPGVFGVLGRAESLPRPFFGIIADGIHLHPTSIKIA
FNAHPEGFILVTDAMHLVGLPDGVYDWGNGERLVKSGPKLTLEGTDKIAGSSISLIECVN
NFLNWSGASIPQALKAVTSTPAAMLNLQGVKGCLDSDADADLTILDEQVDSSGFKSLVVD
QVWKFGSKVFDREE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagccatcacaactgggaggcctacaatcacgaagttcactaattgtagatta
ctgaagggcgatcagttggtcaaccaagatctctgggtttcgtctagtactggaaaaatc
gtgcgaagtcaagaggcattttacagtgaacattcggttccggacatcacaataaatctc
aacggacgtattatatcgccaggtctgatcgacgtccaactcaacggcgcctttggattc
aacttttcttcaataccagaagatccttcaacttacggaaaacttcttagacaagtcaat
aagtctttggtacaaaccggtgtcacttcatacctccctacactcacctcgtcaaataaa
gatgtttaccatcaagcgcttcctcacttgggtccttctggaagatatcgtgtagcttcg
gatggtgctgaatcgcttggtgcacactgcgaaggtccttttataagtcctacgaagaac
ggcatacatcctgtggaagtgcttgtacccgcgccgaatggatttagcgacctcgaggat
atatatggagtggaaaatatcagttctactatcgatcgcgatggaaacattgcaccacca
agaataaggaaaatcactgcagcgccagagattgcagcaatgacaaacacaatccaggag
atcacttcaagagggattgtctattctatcggacataccgaagcgacatatgaggaggct
tccgctgcagtcgcggctggtgcaaccatgataacccacctattcaacgccatgcgacca
ttacaccacagaaatccaggagtgttcggtgtccttggacgagctgagagtctacctcgg
ccattctttgggataatcgccgatggaatccatcttcatcccacaagcatcaagatcgca
tttaacgcacatccagagggattcatcttagtcacagacgcaatgcatcttgttggactt
cctgatggggtatatgactggggtaatggtgagcgacttgtgaagtcgggaccaaagttg
acattggagggcactgataagattgcgggaagctcaatttccttgatcgagtgtgttaac
aactttcttaactggtccggggctagcattccgcaggcactaaaagcagtcacgtcaaca
ccggctgcgatgttaaatcttcaaggcgtcaaggggtgtcttgatagtgatgctgatgct
gatcttaccatactggacgagcaagtcgattcgagcggattcaagagtttggttgttgat
caggtgtggaagtttggaagtaaggtttttgatagagaagaataa

DBGET integrated database retrieval system