KEGG   Glarea lozoyensis: GLAREA_00608Help
Entry
GLAREA_00608      CDS       T04883                                 

Definition
(RefSeq) PLP-dependent transferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
glz  Glarea lozoyensis
Pathway
glz00250  Alanine, aspartate and glutamate metabolism
glz00260  Glycine, serine and threonine metabolism
glz00630  Glyoxylate and dicarboxylate metabolism
glz00680  Methane metabolism
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
glz01130  Biosynthesis of antibiotics
glz01200  Carbon metabolism
glz04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GLAREA_00608
  09102 Energy metabolism
   00680 Methane metabolism
    GLAREA_00608
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GLAREA_00608
   00260 Glycine, serine and threonine metabolism
    GLAREA_00608
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    GLAREA_00608
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:glz01007]
    GLAREA_00608
Enzymes [BR:glz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     GLAREA_00608
    2.6.1.45  serine---glyoxylate transaminase
     GLAREA_00608
    2.6.1.51  serine---pyruvate transaminase
     GLAREA_00608
Amino acid related enzymes [BR:glz01007]
 Aminotransferase (transaminase)
  Class V
   GLAREA_00608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19459666
NCBI-ProteinID: XP_008083557
UniProt: S3DSP1
Position
Unknown
AA seq 434 aa AA seqDB search
MAARERLTAISKHLDHRPLATPRSPIGNSPPNNPPFPSTRSLYTENKPKMSTQPEHPTLL
IPGPIEFDDAVLQSMSHYSESHVGPAFVATFGETLSMLRKLFQTTDTASQPFVLSGSGTL
GWDLVAANLAEPGDDVLVLHTGYFADSFAACFETYGAKPTQLKAPIGSRPQLPEIEKALG
EKKYKILTVTHVDTSTGVLSELKALSELVHRVSPETLLIVDGVCSVGSENIEFDNWKLDG
VITASQKGIGCPAGLSISMYSGRAMDVFKSRKTPPGSYFASMKNWLPIMQNYEAKKPSYF
ATPSPQLIHALNTSLTQILSRPLSDRFAAHQEASQKIKKAIADLGLKQLATDPADQANGM
TAIYLPEGVKAPELLPNLFKKGVVFAGGLHKEIAAKYIRFGHMGVSVTDPKRNDIDKAIK
ALETGLSDVGYQKA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcgtgaaagattgacggcgatatccaaacacctggatcatcgaccgttagca
acaccacggtcaccaattggcaacagcccccccaacaatccgcccttcccttcaactcga
tcattatatacagaaaacaaaccaaaaatgtccacacaaccagaacacccaactctcctg
attccaggtccaatcgagttcgatgacgcagtcttgcagtctatgagccattacagtgaa
agtcatgtgggccctgcatttgttgcgacattcggagaaacattatcaatgctgaggaag
ctgtttcaaactaccgatacagcctctcaaccattcgttctgtctggatctggtacatta
ggatgggatctggtcgcagcaaatttggcagaacctggagatgatgttttggttctgcat
acgggatacttcgcagactcattcgcggcatgtttcgaaacctacggcgcgaagccgaca
cagttgaaggctcctatcgggtcaagacctcaattaccagaaatcgagaaggctcttggg
gagaaaaaatataagatattaaccgttacacacgttgatacgtcaaccggggttctgagc
gaacttaaagctctctccgagttagtgcacagagtgtctcccgagacgctgttgattgtg
gatggtgtgtgcagtgttggaagcgagaacattgagtttgacaactggaagcttgatggt
gttattactgccagtcaaaaaggcatcggatgcccagctggtctttcgatatcaatgtac
agtgggcgtgccatggacgtgttcaagagtaggaagacgccaccaggttcttatttcgct
agtatgaagaactggttaccaatcatgcaaaactatgaggcaaagaagccgtcctatttc
gcaacgccatcaccacaattgatacacgcacttaatacgtccctgactcaaatcctatct
aggccgctttcggatcgatttgctgcacatcaggaagcttctcaaaaaatcaagaaagct
atagctgatctcggcctgaaacaattagccacagaccctgcagaccaggcgaacggcatg
actgcgatctatcttcccgaaggagtgaaggccccagaacttttacctaacttgttcaag
aaaggtgtcgtatttgctggaggcctgcataaagaaattgctgcaaagtacattagattt
ggccacatgggtgtcagcgttactgacccaaaacgaaacgacatcgacaaggccatcaag
gcattggagaccggactttctgatgtaggctaccaaaaagcatag

DBGET integrated database retrieval system