KEGG   Glarea lozoyensis: GLAREA_00837Help
Entry
GLAREA_00837      CDS       T04883                                 

Definition
(RefSeq) Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
glz  Glarea lozoyensis
Pathway
glz00030  Pentose phosphate pathway
glz00480  Glutathione metabolism
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
glz01200  Carbon metabolism
Module
glz_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
glz_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GLAREA_00837
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GLAREA_00837
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:glz04147]
    GLAREA_00837
Enzymes [BR:glz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     GLAREA_00837
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     GLAREA_00837
Exosome [BR:glz04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   GLAREA_00837
  Exosomal proteins of colorectal cancer cells
   GLAREA_00837
  Exosomal proteins of bladder cancer cells
   GLAREA_00837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N DUF3226
Motif
Other DBs
NCBI-GeneID: 19459895
NCBI-ProteinID: XP_008083786
UniProt: S3CTE1
Position
Unknown
AA seq 486 aa AA seqDB search
MADTMIKPEEAPTASTLELKDNTVIVVLGASGDLAKKKTFPALFGLYRNQFLPKDIKIVG
YARTKMDHEEYLKRVKSYIKTPTKDMEQQLADFTKICSYVSGQYDKDDSFIELNKHLEEK
EKGKKESNRVFYMALPPSVFTTVSQHLKKNCYPKNGIARIIVEKPFGKDLASSRELQKAL
EPNWKEDEIFRIDHYLGKEMVKNILILRFGNEFFGATWNRNHIDNVQITFKEPFGTEGRG
GYFDEFGIIRDVMQNHLLQVLTLLAMERPISFSAEDVRDEKVRVLRGIPAIEPKNVIIGQ
YGKSLDGNKPSYKEDDTVPKDSRCPTFCAMVAFIKNERWDGVPFILKAGKALNEQKTEIR
IQFKDVTSGIFKDIPRNELVMRIQPNESVYIKMNSKLPGLSMQTVVTELDLTYRRRFSDL
KIPEAYESLILDALKGDHSNFVRDDELDASSRGPAVLDDFTSSYGYKFSDAAGYQWPTTQ
TAPNKL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgatgataaaaccggaggaggcgcccacggcttcgactctcgagttgaaa
gataataccgtgattgtcgttctcggtgcctccggtgatttggcgaagaagaagacattt
cctgcgctttttggcctttaccgaaaccaattcctaccaaaagatatcaaaatcgttgga
tatgcgcgaacgaagatggatcatgaggagtacctcaagagagtcaagtcgtacattaag
accccaacgaaagatatggagcagcagcttgcggactttaccaaaatctgctcatacgta
tcggggcaatatgataaagacgactcttttattgagttgaacaagcaccttgaggagaag
gagaaaggaaagaaggagtcaaacagagtcttctacatggctctcccaccaagtgttttc
actacagtctcccagcacctgaaaaagaactgttacccaaagaatggtattgccagaatc
attgtcgaaaaaccattcggaaaggatttggcaagttcacgagagctgcagaaggctttg
gagcccaactggaaagaggatgaaatattccgtattgatcactacctgggcaaggagatg
gttaagaacattttgatcctgagatttggtaacgagttctttggtgcaacatggaatcgc
aaccacatcgacaacgttcagatcacattcaaagaaccttttggcacagagggacgtggt
gggtactttgacgagtttggaatcatccgagatgttatgcagaaccatctccttcaggtt
ctgacacttttggcgatggagcgaccaatatctttctccgctgaagacgtgcgagacgaa
aaggtgcgagtacttcgaggcattccggctattgagccaaagaatgttatcattggacaa
tatggcaaatcgctggacggtaacaagccatcatacaaagaagatgatacagtaccaaag
gactcacgatgtccaacattctgcgcaatggtcgcgtttatcaagaatgagcgatgggat
ggtgtgccattcattttgaaggcaggaaaagcgctcaacgagcagaagaccgaaattcga
atccagttcaaggatgtcacatccggtatcttcaaagatatcccacgaaatgagcttgtc
atgagaattcagccaaacgagagtgtctacatcaagatgaactccaagttacctggtctc
agcatgcaaaccgtcgttacggaactcgatttgacataccgaagacgtttctccgacctc
aaaattcctgaggcatacgaatctcttatcctcgatgctctcaagggtgatcactccaat
tttgttcgtgacgacgaattagatgctagctctcgtggacctgctgtcctcgatgacttc
acctcttcctacggttacaaatttagtgatgcggctggttaccaatggcctacaactcaa
acggcgccaaataagttgtaa

DBGET integrated database retrieval system