KEGG   Glarea lozoyensis: GLAREA_00920Help
Entry
GLAREA_00920      CDS       T04883                                 

Definition
(RefSeq) Actin-like ATPase
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
glz  Glarea lozoyensis
Pathway
glz03040  Spliceosome
glz04141  Protein processing in endoplasmic reticulum
glz04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:glz00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    GLAREA_00920
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GLAREA_00920
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    GLAREA_00920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:glz01009]
    GLAREA_00920
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:glz03041]
    GLAREA_00920
   03009 Ribosome biogenesis [BR:glz03009]
    GLAREA_00920
   03110 Chaperones and folding catalysts [BR:glz03110]
    GLAREA_00920
   04131 Membrane trafficking [BR:glz04131]
    GLAREA_00920
   03051 Proteasome [BR:glz03051]
    GLAREA_00920
   03029 Mitochondrial biogenesis [BR:glz03029]
    GLAREA_00920
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:glz04147]
    GLAREA_00920
Protein phosphatases and associated proteins [BR:glz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     GLAREA_00920
Spliceosome [BR:glz03041]
 Complex B
  Other components
   Prp19 complex
    GLAREA_00920
 Complex C
   Prp19-CDC5 complex
    GLAREA_00920
Ribosome biogenesis [BR:glz03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    GLAREA_00920
Chaperones and folding catalysts [BR:glz03110]
 Heat shock proteins
  HSP70 / DNAK
   GLAREA_00920
Membrane trafficking [BR:glz04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    GLAREA_00920
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    GLAREA_00920
Proteasome [BR:glz03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    GLAREA_00920
Mitochondrial biogenesis [BR:glz03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    GLAREA_00920
Exosome [BR:glz04147]
 Exosomal proteins
  Proteins found in most exosomes
   GLAREA_00920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 19459978
NCBI-ProteinID: XP_008083869
UniProt: S3CVV8
Position
Unknown
AA seq 616 aa AA seqDB search
MADEVYDGAIGIDLGTTYSCVANYEGTNVEIIANEQGSFTTPSFVSFTDKERLIGESAKN
QAAMNPKNTIFDIKRLVGRRFDDPTVKKDIESWPFKVIDQDGSPMVEVEYLGENKIFSPQ
EVSAMVLGKMKEVAEVKLGKKVSKAVITVPAYFNDNQRQATKDAGAIAGLNVLRIINEPT
AAAIAYGLGAGKSNKERNVLIYDLGGGTFDVSLLNIQGGVFTVKATAGDTHLGGQDFDTN
LLDHFKKEFTRKTKKDMSGDARALRRLRTACERAKRTLSNGAQTTVEIDSLFDGEDFNAQ
ITRARFEDLNSKAFNGTLDPVAQVLKDANIDKSKVDEIVLVGGSTRIPRIQKLLSDFFDG
KKLEKSINPDEAVAYGAAVQAGILSGKATSADTADLLLLDVVPLSLGVAMEGNIFAPVVS
RGQTVPTIKKSPRTFTTVSDNQQTVQFPVFQGERVNCEDNTSLGEFTLAPIPPMRAGEAV
LEVVFEVDVNGILKVTATEKTSGRSANITISNSVGKLSSSEIENMINDAEKFKNSDDAFS
KKFEARQQLESYISRVEEIVSDPTMSLKLKRGTKDKIETALSDAMAQLEVEDSTSDDLKK
KELALKRVVTKAMSTR
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaggtttacgacggagcgatcggtatcgatcttggcaccacatattcctgc
gttgccaactatgagggaaccaatgttgagatcatcgccaacgagcagggtagctttacc
actccctcattcgtttccttcaccgacaaggagcgcttgatcggagagtctgctaagaac
caggctgctatgaacccaaaaaacaccatcttcgacatcaagcgattggtcggacgaaga
tttgatgatccaaccgtaaagaaggatattgaatcatggcccttcaaggtcattgatcaa
gatggaagccctatggttgaggttgagtatctcggcgagaacaagattttctcgccacag
gaagtttctgctatggttctcggcaagatgaaggaggtcgccgaagtaaaattgggcaag
aaggtctccaaggctgtcatcactgtcccagcctacttcaacgacaatcaacgtcaagct
accaaggatgctggtgccattgccggtctcaacgtcctccgaatcatcaacgagcctacc
gccgctgctatcgcatacggtcttggtgctggaaagtccaacaaggagcgaaatgtcttg
atctacgatctcggtggaggaactttcgatgtttcccttcttaacatccagggtggtgtt
ttcaccgtcaaggctactgctggtgatactcacttaggaggtcaagatttcgataccaac
ctactcgatcacttcaagaaggagttcacaagaaagaccaagaaggatatgtctggcgat
gcccgtgctctcagacgtcttagaaccgcttgcgagcgtgcgaagagaaccctctccaac
ggtgcccagacaactgtcgagatcgactccctctttgatggcgaggatttcaacgcccag
atcacccgtgctcgtttcgaagacttgaactccaaggctttcaacggcactttggacccg
gttgcccaggtcctgaaggatgctaacatcgataagagcaaggttgacgaaattgtcttg
gttggtggatccacccgtattcctcggatacaaaagctcctcagcgatttctttgacgga
aagaagcttgagaagagcatcaatcctgatgaggctgttgcatacggtgccgctgtccag
gccggtatcctctctggaaaggccacctccgccgataccgccgacctcctcctcttggat
gtcgtcccactctccctcggtgtcgccatggagggaaatatctttgcgcccgtagtttct
cgcggacagactgtgcccacaatcaaaaaaagtcccagaaccttcacgaccgtcagtgat
aaccagcaaactgttcaatttccagtcttccagggtgagcgtgtgaactgcgaggacaac
acctccctcggagagttcactcttgctccaatccctccaatgagagccggtgaggccgtc
ctcgaggtcgtcttcgaagtcgatgtcaatggtatcctcaaggtcaccgccaccgaaaag
acctctggtcgttccgcaaacatcacaatctcaaactctgtcgggaagctctcatcgagt
gagatcgagaacatgatcaacgatgccgagaaattcaagaacagtgatgatgctttcagc
aagaagtttgaggccagacaacaacttgaatcatacatttcaagagttgaggagattgtc
tccgacccaacaatgtccctcaagctcaagcggggaaccaaggacaagattgagactgca
cttagcgatgccatggctcagctcgaggttgaggactccacctctgatgatttgaagaag
aaggagcttgcgttgaagagagttgtcaccaaggccatgtccacccgatag

DBGET integrated database retrieval system