KEGG   Glarea lozoyensis: GLAREA_01150
Entry
GLAREA_01150      CDS       T04883                                 

Definition
(RefSeq) Thiolase-like protein
  KO
K15316  noranthrone synthase [EC:2.3.1.221]
Organism
glz  Glarea lozoyensis
Pathway
glz00254  Aflatoxin biosynthesis
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    GLAREA_01150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:glz01008]
    GLAREA_01150
Enzymes [BR:glz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.221  noranthrone synthase
     GLAREA_01150
Polyketide biosynthesis proteins [BR:glz01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal nonreducing PKS (NR-PKS)
    GLAREA_01150
SSDB
Motif
Pfam: ketoacyl-synt SAT Acyl_transf_1 Ketoacyl-synt_C Thioesterase PP-binding PS-DH KAsynt_C_assoc Abhydrolase_6 Thiolase_N Abhydrolase_1 Hydrolase_4
Other DBs
NCBI-GeneID: 19460208
NCBI-ProteinID: XP_008084099
UniProt: S3CWG8
Position
Unknown
AA seq 2235 aa
MSQKVQLFLFGDQTYDFASDFKKLLREENNPILTAFLNQSCFAIRAELNHSLPLKERKAS
FAPTIADLLHKYRQGSLSPAFQTALSCCYQLASFISHFGEIGRSYPQPHDTYIIGLCTGA
LAAAAIGSCSTLSELLPAAVQTVQVAFRLGLCVVDVCSRIESPTGDAAQSWSAVFPGLGT
SEAASLIKDFSESKNIPKTSQPWIGATAGKSTTISAPPSILHLLLSSPSFSTRKSKSIPI
YVPSHNSNLFSLKDVEKILDTTSATNWEGFTAKVPVISSANGQQAWVGNFRGLLEKALFD
CLLEPLRWDAVLSESPTLLAKGVTEVSIIPFATTAATSLASAFKSSLPVTINEPNATKVP
VEALPGGKEKLAIIGMSGRFPEAQSPEAFWDILYKGLDVCKKVPLKRWNVDTHVDPSGKA
HNKGATPWGCWLDFAGEFDPRFFSISPKEAPQMDPAQRMALMATFEAMESAGMVPGTTPS
TQLDRVGVFHGVTSNDWMETNTAQDIDTYFITGGNRGFIPGRINFCFEFCGPSFTNDTAC
SSSLAAIHLACNSLWRGDCDTAVAGGTNMIFTPDGHAGLDKGFFLSRTGNCKAFDDTADG
YCRAEGVGTVFIKRLSDALADKDPILGVILDIKTNHSALSESMTRPHVGAQIDNMNHVLN
TASVDPKSLSYIEMHGTGTQVGDAVEMESVLSVFAPNEAFRGMDYPLWVGSAKANIGHGE
GVSGVTSLAKVLLMMKHDIIPPHCGIKPGNKINRTFPDLGARNVHIAMKPTPWKRGEQPR
RVLISNFSAAGGNTTLVMEDGPIPEVITQTDCRSSHIVTVSGHVANSLKKNLQSLLEYVT
AEEKNGLSLPQLSWTSTARRLHKIHRVSITCSSLTECKAGLQAAIMEGHGTTRSKTKPGL
LFAFTGQGSQYMGMGGTLYESFPRFRASLHRFDQLSQSLGFDSFIHVFQSKAGDIDQFPP
VVVQLAICSLEMALGELLKSFGLEPTLVVGHSLGEYAALNRAGVLSVSDTLFLVGKRAEL
LQSRCNRGTHAMLAVKAPSSSFSGILGDKRYDIACINGPEDTVLSGLNDQIELIRAALSS
KGIKSTLLKVPFAFHSAQVDPILESFIEIASSITFHKPRIPILCPLTGEVIDKADIITPS
YLAKHCRETVNIAAALRYALASKLINQGTITIEVGPQPTVCGMVTKSLGSFMKTLPILHR
TQNLWNNLTSALGTVYSKGHDIDWVEYHSAFPASHKVLDLPAYGWDLKEYYIPYEGDWCL
HRHKIECHCGDLNGVTNHTGKAVGLLTDCKQNAGLENMVEAPKAKIEVEYPETTNVHKLI
EEIMEPLGGTLVFETDMSRADTQSVAAGHAVNNIALCTPSVYADIAFVLGKYLMNRLRPG
YPGIIDVADLVAEKALVPHGKGPQFLRTKFSVAWAPKSAGATKSAECEFWSANASGKLTI
KHAWCTIRFEDTTQLDSLKARLPEFKSKISRLRDGSRKGEFVKYNRTAGYKLMSTVATFH
PDYKLLNHLVLDEPTLEACSKLNFSTVKPGGTFAAHPAYVDSITQVGGFCMNGKDSTDLE
THVFVNHGWHSFQIYEELKNDRDYEVYVQMKHDKGDLYHGDTIVLDGDTIVAFFTGVSLR
CVPRKALRMVLQQTVDKASRELAKTGAVSANSTTSVNPLKSAPRAVSKIIAKSKPQIVSG
TALAHTTSTITTTIPAPVNMSGVAAPSALTSPPTPVAIPPKKQELSPQFVNALAIIAEES
GIAVTDLTDESNFADIGVDSLLSMVIGSRFREELNLELDADFSIFVDLPTVKDLKIFLQG
KDQPLSPEEQPDAALPMVKPLTEAPSVAATYTPEPAFEQKPADVHVLSTVEELPPRKIEG
KITPAPINGTTNTALRIIADESGIAVSDLSDDSNFADIGVDSLLSMVIGSRFREELGLEL
DADFSIFVDLPTVAHLKSFLSGNSSDSDLSEFESSGVISLDESSESEPEDLLVKETQPTR
SDYCKPTSSVILQGMPKTATKTLFLLPDGSGSASSYVSVPKLKGNYAIVGLNCPYARDPE
NMNCTHTALISSFVNEIRRRQQNGPYYLGGWSSGGAFAFVCAEMLVAQGEEVHGLVIIDA
PVPTIMEQLPTSFYEYTATLGLFGQTAPPPYLIPHFRASVDVMMTYKPQVLITERMPKVG
ILWATETLIDEKDVRGMKSMHFMVHKRTDFGPDGWERVLPGAEFLTRRVEGANHFTLMSK
ANIRSVSVIIEDVLA
NT seq 6708 nt   +upstreamnt  +downstreamnt
atgtctcagaaagttcaacttttcctgttcggtgaccagacctacgactttgcttcagac
ttcaagaagctgttgcgagaagagaacaatcccatcttaacagcttttctgaatcagtca
tgtttcgctattcgcgcagagctcaaccattcgctccctttaaaggagcgtaaagcatca
tttgctccgaccattgcagatctcctccacaaataccgccaaggttctctgagtccagca
tttcagacggctttatcatgctgttatcaattggcgagcttcatatctcacttcggagaa
attgggagatcgtatccacaacctcacgacacttacataatcggcctatgtacaggtgct
ctggctgccgctgcaataggatcctgtagtacactatcggagctcctccctgccgctgtt
caaacagtgcaagttgcttttcgtcttggtctttgcgttgtggatgtttgctcccgtatt
gagagccctactggcgatgctgctcaatcttggtctgctgtctttcccggccttggaacc
tcagaagctgcatcattgatcaaggatttcagtgagtcaaaaaatatcccgaaaacttcg
caaccatggattggtgccacggccggaaaatccacaacaattagcgcacctccatccatt
ctccaccttcttttgagctctccctcattttcaactcgtaaatcgaagtccattcctatc
tacgtcccgtcacacaactcaaatttattttcactgaaggatgtcgagaagattctagat
acaacctccgcgacgaactgggaaggtttcaccgcaaaagttcccgtgatatccagtgcc
aatggccagcaggcttgggtaggaaacttcagaggattactggagaaagccctgtttgat
tgcttactggagcctttgagatgggatgcagtgctttccgaatcccctacgctactggcc
aagggagtcacggaggtatcaattataccattcgcaactactgcagcaacaagcctcgcc
tcagcattcaaatcctcattgccagttacaattaatgaaccgaatgcgacaaaagttccc
gttgaagctctacccggcggtaaagagaaactcgccatcattggtatgtcgggcaggttc
ccagaagcacaatctcccgaagcattctgggatattctctacaaaggtcttgatgtgtgc
aagaaggtgccattgaaacggtggaatgtcgacacccatgttgatccaagcggcaaagca
cacaacaaaggtgcaacaccatggggatgttggcttgactttgctggagaattcgaccct
cgatttttcagtatcagcccgaaagaagctccacaaatggacccggcacagcggatggcc
ttgatggccactttcgaagcgatggaatccgctggtatggtgccaggaacgacaccttca
acgcagcttgatagagttggtgtcttccacggtgttactagcaacgactggatggaaacg
aatactgcacaagacatcgacacttattttattaccggtggtaatcgtgggtttatccct
ggccgaatcaacttctgcttcgagttttgtggaccaagttttaccaacgacacagcttgc
tcgtcaagtcttgctgccattcatttagcttgcaactcgctttggagaggtgattgtgat
actgcagtcgcaggaggcacaaatatgatttttactcccgatggtcacgctggtcttgac
aagggtttctttttatcccgaacaggcaactgtaaggctttcgatgataccgccgacggc
tactgtcgagctgaaggcgtggggactgtctttatcaaaaggctgtcggacgctttggcc
gacaaagatccgattcttggtgttattctcgatattaagactaatcattctgcgttgtcg
gagtcgatgacgagaccccacgttggtgctcaaatcgacaatatgaatcacgttctgaat
accgcttctgtcgatccgaaatctctgagctatattgaaatgcacgggaccggcactcaa
gttggagatgcggtcgaaatggaatctgtcttgagtgtctttgcaccaaacgaagccttt
cgtggtatggactacccactatgggttggctcggcgaaagcgaatatcgggcatggcgaa
ggtgtttccggtgttaccagtctcgcaaaagtcctgttgatgatgaaacacgacataatc
ccacctcactgtggtatcaaacctggaaacaagatcaatcgcacgtttcctgatcttggt
gctcggaatgttcatatcgctatgaagcccacaccttggaaacggggtgagcaaccaaga
agggttctaatcagcaatttcagtgctgctgggggcaatactacgctggtgatggaggat
gggcctattcctgaagtcattacgcaaacggattgtcgctcaagtcatattgtcacagtt
tctgggcacgttgcaaattctttaaagaaaaacctccagtcgcttctcgaatacgtcact
gcagaagaaaagaatggtctctcactcccacaactttcctggacgtccacagctcgccga
ctacataagattcatcgtgtcagtatcacttgctcatctctgacggaatgtaaagccggg
cttcaagccgccattatggaaggtcacggtactacgaggtcaaagaccaagccaggttta
ctctttgcttttactggccagggttcacagtatatgggcatgggcggcacattgtatgag
tcgttccctcgcttccgagcgtcccttcaccgattcgatcaactttcccaaagccttggt
tttgattcattcattcatgttttccagtctaaggcgggagatatcgaccagtttccccca
gttgttgtacagctcgcgatatgttccttggaaatggcgttgggcgaacttctcaaaagt
tttggtttggagccaacccttgttgtcggtcatagcctcggagaatatgctgcactcaac
cgagccggcgtactatcggtctctgacactcttttccttgtgggcaagcgagcagagctg
ttacaaagccgctgcaatagaggtacccatgctatgttggctgtcaaagctccatcatca
tctttttcgggcatccttggcgacaaaaggtacgacatcgcatgtatcaatgggccagag
gatactgtactgagtggtttgaatgatcaaatcgagttgatccgagccgctctctcgtca
aagggaatcaaatctacgttgctcaaagtcccatttgcattccactccgctcaagtcgac
ccgatccttgaatctttcatcgaaatcgcttcctccataacatttcacaaaccaaggatt
ccaatcttgtgtccattgaccggagaagtcatcgataaagctgacataatcaccccttcc
tacctcgccaaacactgccgagaaactgttaacattgctgcagctctaagatatgccctt
gcttcgaaacttatcaatcagggtaccataactatcgaggttggacctcagccaacggtt
tgcggaatggtcaccaagagtcttggatctttcatgaagactttaccaatacttcaccgc
acacaaaacctttggaataatttaacatccgcgctaggcacagtctattctaaaggccat
gatatcgactgggtggagtaccacagcgcgtttccagcatcgcataaagtgctcgatctg
ccagcttatggatgggatttgaaagagtactatattccttacgagggtgattggtgtttg
catagacataaaattgagtgtcactgcggggatctgaatggggttaccaatcatacaggg
aaggctgtcggtcttttgacggattgcaagcaaaatgccggactagagaatatggttgag
gctcccaaggctaaaattgaggtggagtacccagaaaccactaatgtacacaagctcatc
gaggagatcatggagcctcttggtgggaccttggtctttgagacggatatgagcagggcc
gacacgcagagtgttgccgccggccatgcggtcaacaatattgcactctgcacaccatca
gtgtacgcagacattgcttttgtccttggtaaataccttatgaaccgcctgagacctggc
tatccaggtattatcgacgttgcagacctagtagcagaaaaggcactcgttccacacggg
aaaggtcctcaattcctccgtactaaattcagcgtcgcttgggcccccaaatccgctggc
gctacaaagagtgcggagtgcgaattctggtcagctaatgcgagtggtaaacttaccatc
aaacatgcttggtgtacaatccgctttgaagatacgactcagcttgattctctgaaggct
cgtcttcctgaatttaagtccaagatcagccgtctccgagacggttcgcggaaaggagaa
tttgtgaagtacaatcgtacagcaggttacaagctcatgtcgactgttgcaactttccat
cccgattacaagctactcaaccatctcgttttagacgagcccaccctagaagcatgtagc
aaactcaatttttccaccgtcaaacccggtgggactttcgccgctcatcctgcgtacgtg
gattccatcactcaagttggtggattctgtatgaatggtaaggatagtactgatctcgaa
actcatgtatttgtcaaccatgggtggcacagtttccagatctacgaggagttgaagaat
gatagggactatgaggtgtatgtgcagatgaaacatgacaagggtgatctctaccatgga
gataccattgttctggatggagatactattgtggctttcttcacaggcgtttcgttgcga
tgtgttccccgaaaagcattgagaatggttctccagcaaactgtggataaagcttctagg
gagttggcaaagactggagcggtttcggcaaattctacgactagtgttaaccctctcaaa
tctgctccaagggcagtcagcaagattatcgctaaatccaagccccaaatcgtatccgga
acagcactagcacatactaccagtactatcacaactactatacctgctccagtaaatatg
agcggcgttgcagctccatcagcactgacatctcctccgacaccagttgccataccacca
aaaaaacaagagctcagtcctcaatttgtcaatgctttagcgataatcgctgaagagagt
ggtatcgcagtcacggacctgacagatgagagcaactttgccgatattggagttgattcc
ctactgtcaatggtgattggtagtagattccgagaagaactcaatttggaacttgacgcc
gatttctcgatctttgtggatcttccgactgttaaagatctgaagatatttttgcagggt
aaagatcaaccactttcgcctgaggaacagccagacgcagcacttccgatggtcaaacct
ttgacagaagctccttcggtagccgcgacttacacacccgagccggcatttgagcagaaa
ccagcagatgtccacgtgctgtcaactgttgaagagttacctcctcgtaaaattgaagga
aagattacaccagctccaataaatggcaccacaaatacagctctacggattatagctgac
gaaagtggtattgctgtctcggacctcagcgacgacagtaactttgccgatattggagtc
gactcccttctctctatggtaatcggctcccgcttccgcgaagagctgggcctagaactt
gatgccgatttctccatttttgttgatctcccgacagttgcacacctcaaaagtttcctc
tccggcaacagctccgatagcgatttatccgagtttgaatcgagtggagtcatctctcta
gacgaaagctccgaatccgagccagaagaccttctcgttaaagaaacccaaccaacacga
tccgactattgtaaacccactagctcggtgattctccaaggcatgcccaagacagccaca
aagactctctttctcttgccagacggcagtggctccgcatcaagctacgtctcagtccca
aaactaaaaggcaactacgcaatcgtcggtctcaactgcccatacgctcgcgacccagag
aacatgaactgcacccacacagctctcatcagcagcttcgtcaacgagatccggcggcgt
cagcagaacgggccttattatctcggcggctggtccagtgggggagctttcgcattcgtc
tgtgctgaaatgctcgttgctcaaggcgaagaagttcacggtctggtcataatcgacgcg
cctgtgccaacaatcatggaacaactcccgacctcattctacgagtatactgctaccctt
ggactttttggccagactgctccgcccccttatcttatcccgcatttcagagcctccgtc
gatgtcatgatgacttacaagccgcaggtcttgataactgagagaatgccaaaggtgggc
atcctgtgggccacagaaactttgatagatgagaaagacgtgagagggatgaaaagtatg
catttcatggttcataaaagaaccgactttggaccggatggatgggagagggtattgcct
ggtgcggagtttttgacgagacgggtagagggcgcgaaccactttacattaatgtcgaag
gcaaatattagatctgttagtgttatcattgaggatgtgttggcatag

DBGET integrated database retrieval system