KEGG   Glarea lozoyensis: GLAREA_01823Help
Entry
GLAREA_01823      CDS       T04883                                 

Definition
(RefSeq) Arabinanase/levansucrase/invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
glz  Glarea lozoyensis
Pathway
glz00052  Galactose metabolism
glz00500  Starch and sucrose metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    GLAREA_01823
   00500 Starch and sucrose metabolism
    GLAREA_01823
Enzymes [BR:glz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     GLAREA_01823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 19460881
NCBI-ProteinID: XP_008087230
UniProt: S3D1K7
Position
Unknown
AA seq 571 aa AA seqDB search
MMLKNVVFLAAAVAAQTSMAPTNSTTAAVPTSTVFDEGVPTDQPIAGDYSGVWRPQVHFS
PPTEFMNDPNGMFVDANGTYHLYYQYNPTATVAGNQHWGHATSTDLYHWQNQKIAIFATE
NSQIFSGSAVIDVNNTSGFFPNQDNGVVAIYTLNTPYAQVQEIAWSIDGGYTFEKYSGNP
VLELSPNSTQFRDPKVVWYEDHWVMVIAYSQEFVIGVFTSPDLKEWTHASNFSHHGLLGL
QYECPNLVQMPVEGGDPMWVLTISINPGAPLGGSITEYFPGTFNGTHFTAVDAAARLGDF
SKDNYAGQFFYGIPPTEEQIYIGWASNWEYSQVVPTGQSEGWRSAMTVPRRTKLANVTRV
GWNMMDQPYDLSPILDSPLATNDSLGNGSIFIDYSSLDSKAIYFQCNVSSIPNGTYSMGT
LNFTFSSSQTQESVSGGFFFGGDNPFWMNRGKVLGFGETNPFFTDKFSVGNPINANGTFV
LEGIIDRSILEVFLDQGRAVGTMTFFPEGVLDTMVLKTAGLNEGVVVSVAVWGLKSAWAE
YENEEGIVMGNVTSASNSTQAMRRNLGARLY
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcaagaacgttgtgtttttggctgcggccgttgccgctcaaacttccatggca
cctaccaattcgacaacagctgccgttccgacctcaaccgttttcgacgagggtgtccct
actgatcaacctatcgctggtgattacagtggtgtatggagaccacaagtccatttttcg
cctcctactgagttcatgaatgatcccaatggaatgttcgttgatgccaatggaacttac
catctttactaccaatacaacccaactgcgaccgtggcaggaaatcaacactggggccat
gccacctctacggatctttaccattggcagaatcaaaagattgctatctttgctacagag
aactctcaaatcttctccggatcagcagtcattgatgtcaacaacacatcaggcttcttt
ccaaatcaagataatggcgtagttgcaatctacactcttaatactccatatgctcaagtt
caagagattgcttggtcaattgatgggggctatacattcgagaagtactctggaaacccg
gtattagaattgtctcccaactctacacaattcagagatccaaaagttgtctggtatgaa
gatcattgggttatggtgattgcatattctcaagaattcgtgattggagtctttacctct
ccagatttgaaagaatggactcatgcttccaacttttctcatcatggccttctcggtctt
caatacgaatgtcctaatctcgtccaaatgccggtggaaggcggcgacccaatgtgggtt
ctgaccatctccatcaacccaggcgcacctctcggcggttcaatcacagaatacttccca
ggcaccttcaatggcacgcacttcaccgccgttgacgcagctgccagactgggcgacttc
tccaaagacaactacgccggtcaattcttctacggcatccctccaaccgaagaacaaatt
tacattggctgggcctcgaactgggaatacagtcaggtggttcccaccggccaatctgaa
ggctggcgctcggccatgaccgttccaagacgtaccaaactcgcaaacgttacccgcgta
ggctggaacatgatggatcaaccttacgacctaagccctatcctcgacagcccactcgct
accaacgactccctcggtaacggctccatctttatcgactactcctccctcgactcaaaa
gcaatctacttccaatgcaatgtctcctccatacccaacggcacttactccatgggaacc
cttaacttcaccttttcgtcctcacaaacacaagaatccgtctccggaggcttcttcttc
ggtggcgacaatccgttctggatgaaccgcggtaaagtcctcggattcggcgagaccaat
ccgtttttcacggataaattctctgttggaaatccaattaatgcgaatggaacgtttgtg
ctcgaggggatcatcgatcgtagtattcttgaagtattcttggatcaagggagagcagtg
gggacgatgacgtttttcccagagggggttttagatacgatggtgcttaagacagcgggc
ttgaatgagggtgtggtggttagtgtggctgtttgggggttgaagagtgcgtgggcggag
tatgagaatgaggaggggattgtgatggggaatgttacgagtgctagtaatagtacgcag
gctatgaggaggaatttgggtgcgaggttgtattga

DBGET integrated database retrieval system