KEGG   Glarea lozoyensis: GLAREA_02091Help
Entry
GLAREA_02091      CDS       T04883                                 

Definition
(RefSeq) FAD/NAD(P)-binding protein
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
glz  Glarea lozoyensis
Pathway
glz00730  Thiamine metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    GLAREA_02091
Enzymes [BR:glz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     GLAREA_02091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 Lycopene_cycl NAD_binding_9 Pyr_redox_2 FAD_binding_2 K_oxygenase FAD_binding_3 Trp_halogenase Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 19461149
NCBI-ProteinID: XP_008087498
UniProt: S3CLV6
Position
Unknown
AA seq 328 aa AA seqDB search
MSPPVAMFEERRSSEVDSAPLKSSFDVKSFPVRSSKSKTLDELADQWENGFTFAPIRESQ
VSRAMTRRYFNDLDNYAESDIVIVGAGSCGLSTAYMLGKARPDLKIAIIEASVSPGGGAW
LGGQLFSAMVMRKPADAFLTDLGVPFDDEGDFVVVKHAALFTSTLLSKVLSFPNIKLFNA
TAVEDLITRQNSDGTLRIAGVVTNWTLVTMHHDDQSCMDPNTINAPIVVSTTGHDGPFGA
FCVKRLVSMQQIEKLGGMRGLDMNTAEDAIVKRTREVVPGLVVGGMELSEVDGANRMGPT
FGAMALSGVKAAEEVLKVFDERKKQNAY
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaccagtcgccatgttcgaagagcgtcgcagctctgaagttgacagtgctcca
ttgaagtcgagctttgatgtcaaatccttcccagtccgttccagcaagtccaagactctt
gatgagctggccgatcaatgggagaatggctttacttttgctcctatccgcgagtctcaa
gtctctcgtgctatgacccgtcgttacttcaacgatctggacaactatgccgagtcagac
attgtcattgtcggagctggatcttgtggtctcagcactgcttacatgctcggcaaggct
cggcctgacctgaagattgccatcattgaggcatctgtctcaccaggtggtggtgcttgg
ctcggtggccagcttttcagtgctatggtcatgcggaaacctgccgatgcatttctcact
gatctgggtgttccattcgatgatgaaggagactttgtagtagtgaagcatgcagcactc
ttcacctccacccttctgtccaaagttctctcgttcccgaacatcaagctctttaacgcc
acagccgtcgaggatcttatcactcgccaaaactcagacgggactctacgtattgctggt
gttgttaccaactggacactggtgaccatgcaccacgatgaccaatcctgcatggaccca
aataccatcaacgcacctatcgttgtctcgaccactggtcacgatggtcccttcggtgcc
ttctgcgtcaagcgtcttgtatctatgcaacagattgagaagctgggtggcatgagaggt
cttgacatgaacaccgccgaggacgctatcgttaagcgaactcgtgaagtggtccctgga
cttgttgttggtggtatggagttgagtgaggtcgacggtgccaaccgaatgggtcctaca
tttggcgccatggcactttctggagtcaaggctgccgaggaagtcttgaaggtattcgat
gagagaaagaaacagaacgcctactag

DBGET integrated database retrieval system