KEGG   Glarea lozoyensis: GLAREA_02615Help
Entry
GLAREA_02615      CDS       T04883                                 

Definition
(RefSeq) (Trans)glycosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
glz  Glarea lozoyensis
Pathway
glz00460  Cyanoamino acid metabolism
glz00500  Starch and sucrose metabolism
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLAREA_02615
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    GLAREA_02615
Enzymes [BR:glz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     GLAREA_02615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-GeneID: 19461672
NCBI-ProteinID: XP_008085892
UniProt: S3CJK7
Position
Unknown
AA seq 965 aa AA seqDB search
MSHKKEASQSREGLLRSYDQGENIPLRKSLEEAYASDSGSDIDATEFLDRDPLAEQSQPA
VVAYGPAARLRNLRTAFNRRSKCAIIIITVLVVIWSILAGGGFFLYKKKPVDGQSPPWYP
TPPGGTVMQWSDSYKKAAELVRKMNLLEKVNITTGTGWQMGLAVGNTAPATNVGFPGLAL
QDGPLGLRFADNATAFPAGITVGATWNKELMYLRGKAHGKEARLKGVNVLLGPCVGPLGR
MPAGGRNWEGFGTDPVLQGIAAAQTIKGIQEEGVIATIKHFVGNEQEHFRQSWEWGLPNA
MSSNIDDRTLHEMYGWPFADSVKAGVASVMCSYQMTNNSYSCGNSKLLNGYLKDELGFQG
FVQSDWLAQRSGVGSALAGLDMSMPGDGLIWANGKSLWGPELTKSVLNGSLPIDRLNDMV
TRVVASWYQLGQDDTSRFDGKGPNFSSWTNDKLGRINHGSPDDKDEKVVNQFINVQGDGE
DSHRIIAREVATEGTVLVKNDDNVLPLLRDGWLSEDKHEIKMRIGIFGEDSGAGDGPNAC
ADRGCNQGTLGSGWGSGAVEFPWLITPVEALKEAFNKDRVYVTDFPTNAPPLKKAPAILK
DQDFCIVFVNADAGEGFISSGGIKGDRNDLNIQKGGDELIKKVSEGCGEGNGKTIVVVHS
VGPVVVEKWVNLPGVKAVIMANLPGQESGYAIADILIGNVNPSGKLPYTIGKSLDDYGEG
AKILYYANGVIPQQTFSEGLYIDYRHFDKFGVDPTYEFGFGLSYTTFEYSNLVVNKLREK
TPLPSPRPTGVQAPKFDTNIPSPTEALFPEGFKKLKKFIYPYIEKVSDIKPGKYPYPEGY
NTIQLPSEAGGDEGGNPDLWNVYAEVSVDIQNTGTRAGKEVAQLYVSYSDVTGEAKKVDF
PIKVLRGFEKVFLKVGEKQSVKFNLTRRDLSYWDVVRQNWVMPSEGQITVRVGASSRDLK
LTGWY
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaaaaaggaagcaagccagagtcgggagggtctgcttcgatcgtatgaccag
ggagaaaacatacctttgcgaaaatctcttgaggaagcctacgcatccgacagcggttcc
gacatcgatgccaccgaatttctggaccgagatcctctcgccgagcagtcgcagccagca
gttgttgcgtacggaccagcagcgaggttacgaaaccttcgaacggctttcaaccggcgg
tcaaaatgtgcgataatcattataactgtcttggttgtcatatggtccatactggcagga
gggggattcttcctgtataagaagaagccggtagatggacagtcaccaccatggtatccc
acaccacctggaggaacggtcatgcaatggagcgatagttacaagaaagctgccgagttg
gtgagaaaaatgaatttgctggaaaaggtcaacatcacaactggcactggttggcagatg
ggacttgcggttggcaataccgctcctgcgacgaatgttgggttcccaggattggcgtta
caagatggacctttaggactgagatttgcggataatgctaccgcttttcctgctggaatc
acggttggcgcgacatggaataaggagttaatgtatctcagaggtaaggcgcacggaaag
gaagctcggttgaagggagtcaacgtgctattgggaccttgtgttgggccgcttggacga
atgcctgctggcggaagaaattgggaaggattcggaaccgatccagtcttgcagggaatt
gccgctgcccagacgattaaaggaatacaagaggaaggcgtcattgctactatcaaacat
tttgtcgggaatgaacaagagcatttcaggcagagttgggaatggggtttaccgaacgca
atgtcttcgaacattgatgacagaacgctccatgagatgtacgggtggccgtttgcggat
tccgtaaaagctggtgtggcaagtgtaatgtgctcataccagatgacgaataattcttac
tcctgcggcaactccaagttactcaatggataccttaaggatgaattgggattccaaggt
tttgtccaatctgactggcttgctcaacgatcaggggttggaagtgctctagccgggctg
gatatgagtatgcctggagatggactaatctgggcaaacgggaagtctctttggggtcca
gagctcacaaaatcagtcttgaacggctctttacctattgataggcttaatgacatggtc
accagagttgtggcttcttggtatcaactgggacaagatgatacatccagatttgatgga
aaagggcccaatttcagttcttggactaatgataagctcggccgtatcaatcatggaagt
cctgatgacaaggatgagaaggtcgtcaatcaattcattaatgtccaaggagatggagaa
gattctcaccgtatcatcgcgcgagaagtcgctacggagggtaccgtactcgttaagaat
gatgataatgttctgccacttcttagagacggttggctgtcagaagataaacacgaaatc
aaaatgcgtataggcattttcggcgaggattccggagctggcgatggtcccaatgcgtgc
gccgatcgaggttgtaaccaaggaacattgggttctggatggggttccggcgctgtggag
tttccatggctgattacacctgttgaagctctcaaggaggcattcaataaagatcgcgtt
tatgtcacggattttccaacaaacgcaccacctctgaagaaagctccagcgattttgaaa
gaccaagacttctgtatcgtcttcgttaacgccgatgctggtgaggggttcatttcatct
ggcggtatcaagggcgacagaaatgacctcaacattcagaaaggtggagatgaattaatc
aagaaggtctcagaaggctgtggagaagggaatgggaagaccattgttgtagtacactcg
gtcggtccagttgtggttgagaaatgggtcaatctgcctggtgtaaaagccgtaatcatg
gccaacttacctggccaggaaagcggttatgctatcgcagacattcttatcggaaatgtc
aaccctagtggcaagctcccatatacgattggtaagtctcttgatgattacggcgaaggt
gccaagattctgtattatgccaacggcgtaatacctcaacaaacattctccgaaggcctt
tacatcgactacagacactttgacaaatttggcgttgatcccacctacgagttcggtttc
ggtctttcatatactacattcgagtattcgaatcttgtggtgaacaagctacgggagaag
acaccgctcccttctccaagacctactggtgtccaagccccgaagtttgacacaaatatt
ccaagtccaaccgaggccttattcccagaaggcttcaagaagctgaagaagttcatctac
ccttacatcgaaaaggtgtccgacatcaagcctggtaaatatccatacccagaaggatac
aataccatacaactaccctcagaagccggcggtgacgaaggcggaaaccctgacctgtgg
aatgtctacgcggaagtatcagtagacatccaaaacactggcacacgagctggcaaggaa
gtcgcgcagttatatgtcagttactcggacgtcacgggtgaagcgaagaaagtcgacttc
cccatcaaagtattaagaggctttgagaaggtctttttgaaagtaggcgaaaagcaatct
gtcaaattcaatttgacgagacgagatcttagttattgggacgtggtgaggcagaattgg
gttatgcctagtgagggacagattacagtgagggtcggggctagttcgagggatttgaaa
cttacggggtggtattaa

DBGET integrated database retrieval system