KEGG   Glarea lozoyensis: GLAREA_02795Help
Entry
GLAREA_02795      CDS       T04883                                 

Definition
(RefSeq) Succinyl-CoA synthetase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
glz  Glarea lozoyensis
Pathway
glz00020  Citrate cycle (TCA cycle)
glz00640  Propanoate metabolism
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
glz01130  Biosynthesis of antibiotics
glz01200  Carbon metabolism
Module
glz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
glz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLAREA_02795
   00640 Propanoate metabolism
    GLAREA_02795
Enzymes [BR:glz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     GLAREA_02795
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GLAREA_02795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig ATP-grasp_2 BRCA-2_OB3 CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 19461851
NCBI-ProteinID: XP_008086071
UniProt: S3D493
Position
Unknown
AA seq 639 aa AA seqDB search
MLRHTVLRGRPVGGAIRKRDFGSTKRRLGYEDTIENLRIGKDTRVIFQGFTGRQATANAK
ESLAWGTNIVGGVTPGKDGEHLGKPVLPTVREAMKQLKPDATGIYVAAHQAPAAIEEAIE
AEVPLIVAVAEHIPIHDIMRIHSILKTQSKSRLVGANAPAVASTTRAGLGQSLCIGMGGD
VLAGTNFVDALKIFENDEDTKGIVLIGEIGGWAEIEAADWIKDYRKRNSNPKPISALIGG
VNAAPGRVMGHAGAFTLPGEPDALMKIKALEQAGVTVVNHPEKFGDAMKTLLGSSGRASS
GSSATGSQRRGMHTMRSRPTREVLTKISSQKRSLHIRENLALDLLREKGINASEYSGTGR
RRMLAVGVDRSGRSPCIIASPASIPENPHKESKRFLFDYRRGFDPIRAAAVAEHLHLAES
AKESLPKLINGLIDLFKKKEALILETLFVERLGDLKVVGANFTFDDAAFRSTKRQADIHA
LRRIEDEDPQEVEAEEDGIVYIKFAGDGNIGTLVNGAGLAMNTVDALADAGGKAANFLDT
GGKATSETVKKSFQVILQDERVKVIFVNIFGGLTLGDMIANGVLLAFKELEMRIPVVVRI
RGTNEEEGQRIIAESGLSLHAYDDFEAAAAKAIELANSS
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggcatacggtactgcggggtcgtcccgtaggtggagccatcagaaagagagac
tttggaagtaccaaaaggagattgggatatgaggataccatagaaaatttgaggatagga
aaagatactagagttattttccaggggtttacaggaagacaagccacggcgaacgcaaaa
gaatctctggcatgggggacgaatatagtgggcggtgtgacgccagggaaggatggcgaa
catttgggtaaaccagttttacctaccgtcagagaggcaatgaaacaattgaagccggac
gccacaggaatctacgtggcagctcatcaggctcctgctgcgatagaagaggccattgaa
gcggaagttccattaatcgttgctgttgcggagcacattcctattcatgatattatgcga
atacattctattttgaaaactcagtcgaaatcgagacttgtaggtgcgaatgccccagcg
gttgcatctacaactagagcgggacttggacaaagtctttgcataggaatgggaggggac
gtactcgcaggaaccaactttgtagatgcactcaagatttttgaaaatgacgaggacacc
aaagggatagtgctaatcggtgaaattggtgggtgggctgagattgaagcagcggattgg
attaaagattatcgaaaacgaaattcaaacccaaagcccatatcagctcttattgggggt
gttaatgctgctcctggccgtgttatgggacacgcaggagctttcaccttgccaggagag
ccagatgctctgatgaagataaaagcgttggagcaagctggggttactgtggtcaaccat
cctgagaaatttggagatgcgatgaaaactttgttgggaagttcaggacgagcgagcagt
ggatcgagtgcaacgggctctcagagaagaggaatgcatactatgagatctcgtccaacc
agagaagttctgacaaagatttcgagccagaaaagatcactccatatcagagaaaattta
gcgctcgatcttctgcgagaaaagggtataaatgcctcagaatactccggtacaggacga
agacggatgctcgcagtgggtgtcgaccgaagtggcagatccccttgcatcattgcctcg
ccagcttcaattccagaaaatccacacaaagaatccaaaagatttctattcgattacagg
aggggatttgatcccatccgagcagcagcagttgccgagcacttacatcttgcggaatcg
gcaaaggagtcgttaccaaaattgatcaacggattgatcgacctgtttaagaaaaaagaa
gctttgattttagaaacacttttcgtcgagagattaggagatctaaaagttgtaggtgcg
aatttcacatttgacgatgctgcatttcgcagtacgaaacgtcaagccgatatccacgca
ctccgtcgcatcgaagacgaagatcctcaagaggttgaagcagaggaagacggtatcgta
tacatcaaattcgcaggagatggaaacattggcacattggtcaatggggcaggtcttgcc
atgaacacagtagacgctcttgcagatgcgggaggtaaagcggcgaattttctggataca
ggcgggaaggctacaagtgaaactgtgaaaaagagcttccaggtcatattgcaggacgag
cgggtgaaggtgatctttgtgaatatctttgggggcttgacgctgggtgatatgattgcg
aatggggtgttattggcgttcaaggagttggagatgagaattcctgttgtggttaggatt
cgtggcactaatgaggaagagggtcagagaattattgctgaatcggggttgtcacttcat
gcgtatgacgattttgaggcagcggctgcgaaagctattgagcttgcgaatagttcttga

DBGET integrated database retrieval system