KEGG   Glarea lozoyensis: GLAREA_03717Help
Entry
GLAREA_03717      CDS       T04883                                 

Definition
(RefSeq) N-terminal nucleophile aminohydrolases (Ntn hydrolases)
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
glz  Glarea lozoyensis
Pathway
glz00430  Taurine and hypotaurine metabolism
glz00460  Cyanoamino acid metabolism
glz00480  Glutathione metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    GLAREA_03717
   00460 Cyanoamino acid metabolism
    GLAREA_03717
   00480 Glutathione metabolism
    GLAREA_03717
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:glz01002]
    GLAREA_03717
Enzymes [BR:glz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     GLAREA_03717
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     GLAREA_03717
Peptidases and inhibitors [BR:glz01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   GLAREA_03717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 19462772
NCBI-ProteinID: XP_008082161
UniProt: S3CYT9
Position
Unknown
AA seq 568 aa AA seqDB search
MFPLASFVLGLSVVGLAVAHPKSHNSTEAKRGAVASEAAVCSQIGIDILKAGGNAADSLV
ATQLCVGVVAMYHSGIGGGGFMTVRSSNGSYEFIDFRERAPAASFELMYSPPLSNVNLSL
YGGLASGVPGELRGLEYLHKKYGCLPWKKLVMPSVKLARYGFRVTEDLVRYMGGASFLSQ
DSTWAIDFAPNGTLVRLNDTMTRKRYANTLEEIAEHGPDAFYTGAIANATIVALQKSNGT
MTLADLANYTIELRPTSNITYRGYKLHTGSAPSSGAVVLSALKIVEGYDMSTPSALNLST
HYLDEAMRFAYGQRTLLGDATFLPNLTKYQRDMYSEKTAAEIRALIQPGATLNTTVYNPS
NYDILTDDGTSATVSADKSGLTIACTSTINTIFGSRLMIPELGVIMNNEMNDFSVPNTTN
AFGYIPTEANYIKPFKRPLSSISPTIVEYPNGTVFISHASAGGSRIITEIIQHLWHVIDQ
KMTSAQALRQPRFHDQLSPNTVSFEYAGDAFGVPGYSNETTAYFKEIGANVAFVAVGSTT
AQAIRVLENGTFEAAGEPRQLNSAGYAF
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgttcccccttgccagcttcgttctcggccttagtgttgtcggcctagccgtcgcccat
cccaaatctcataacagtacggaagccaaacgtggagctgttgcttctgaggcggctgtg
tgctctcaaattgggattgacatacttaaggcaggtggaaatgctgcggactctctcgta
gcaacccagctatgcgtgggagtggttgcaatgtatcattcgggaatcggaggagggggt
ttcatgaccgtccgctctagcaatgggtcttacgagtttatcgatttcagagaaagagca
ccggctgccagttttgaactgatgtattctccacctctctctaacgtgaacctctcactt
tacggtggattggcgtccggggtacccggtgaactgagaggtctcgagtatctacacaag
aagtatggctgcttgccctggaaaaagctggttatgccttccgtaaaattggcgaggtac
ggctttcgagtaacagaggatttggtaaggtatatgggtggggcttcctttctcagtcaa
gactcgacttgggcgattgactttgctcccaatgggactttggtacgattgaacgacacc
atgacaagaaagcgttatgcaaatacgcttgaggaaatcgccgagcatggccccgatgcc
ttttatactggtgcaattgcgaatgccacaattgtcgcacttcaaaaatccaatggcacg
atgacactggccgatcttgcaaactacaccattgagctcagaccgacctcaaatatcaca
tacaggggctacaaacttcacactggaagtgcaccgtccagcggggccgttgtgctgagt
gctctcaaaatcgttgaaggatatgacatgtcaacaccatctgcgcttaacctttccaca
cactatcttgatgaagccatgcgattcgcctatggtcagcgaactcttcttggagatgct
actttcctcccaaatctaacgaagtatcaacgagatatgtactcggaaaagaccgctgcc
gaaatccgagcactgatacaaccaggtgctacgctaaatactacagtgtataacccatcc
aactacgacatcttaactgatgacgggacatcagcaacagtgtcagcagataagagcgga
ctaaccatcgcatgcacaagtacgatcaatactatattcggaagccgtctcatgattcca
gagcttggtgtgatcatgaacaacgagatgaacgatttcagtgtacccaacactaccaac
gctttcggatatatccctactgaagccaattacatcaagccgttcaagagaccactctca
tctatctcgccaactattgttgagtatcctaatggaacggttttcatctcccatgcatcc
gccggaggttctcggatcatcaccgaaatcattcaacatctatggcatgttatagatcag
aagatgacgtccgcgcaagctcttcgtcaacctcgctttcacgaccagttatcgccaaat
acagtctctttcgagtatgccggggatgcatttggagttcccggatatagtaacgagaca
actgcatactttaaggagattggtgctaatgttgcgtttgttgccgtcggctcaacaaca
gctcaagctattcgtgttctggagaatggaacatttgaggctgctggagaaccacggcaa
cttaattctgcgggttatgcattttag

DBGET integrated database retrieval system