KEGG   Glarea lozoyensis: GLAREA_04449Help
Entry
GLAREA_04449      CDS       T04883                                 

Definition
(RefSeq) Arabinanase/levansucrase/invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
glz  Glarea lozoyensis
Pathway
glz00052  Galactose metabolism
glz00500  Starch and sucrose metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    GLAREA_04449
   00500 Starch and sucrose metabolism
    GLAREA_04449
Enzymes [BR:glz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     GLAREA_04449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975 Glyco_hydro_43 DUF4185 RBM1CTR
Motif
Other DBs
NCBI-GeneID: 19463504
NCBI-ProteinID: XP_008085017
UniProt: S3DMB4
Position
Unknown
AA seq 557 aa AA seqDB search
MSFTRFRPTSHFIAPHSWSNDPCGAVYVPETKEYLFCYQWNPGTTEGGNSAWGMAKSKDL
VTWTDCSPPITNGAAGSYDQKGVFSGSIVSRVIDGKTALFLFYTSVSRLPIHWSKEYLEG
CESQSVAFSTDYGVSWHRYENNPLLSVPPKRELSTGWRDPFVSPWTTLSRFLGVDEATDY
MMIASGERGRGSALHLYSSNNLLGWDLCSTILEVETNTPVSPTSSFIWGMNFECASFFNI
GESNYILVGIEEDIPSTRHNRHLTLWLRGEFVLENGKPKFNILSHGMLDFGILYAIHIFR
DAEGRLLQLGWADESANAKTIKQQGWAGCIAHPRELYEISKPIADSISEEDIWYVDEKAG
RMTALGIRPAPQISQVRDSRTQIPLENFKSIRSKNYEIKTTFKKPTGTEEFTFNVRQSPN
KEELTKIIFDLANSTISVDRSKSSLENLGSSFTEIGRFTLLPDEDLDIRLFVDNSIIEVY
ANDRFALTSRIYPSLESLGVDYDFGGFEEENVGFWCWEGLKDAWPTRREGSVESSAEDVT
VDEKGVVQVMERPIVVV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcacacgcttccgaccaacttcacatttcatcgcaccccactcatggtccaac
gacccatgcggagccgtctacgtcccagaaaccaaagaatacctcttctgctaccaatgg
aacccaggaaccaccgaaggcggcaactctgcttggggaatggccaagagcaaagactta
gtgacatggacagattgcagtccaccgatcacaaacggtgcagcaggatcttacgaccaa
aaaggtgtcttctcggggtctatagtctcgagggttattgatggaaagacggctttgttt
ttgttttatacgagtgtttcgagacttccaatacattggtcaaaggaatatctcgagggt
tgcgaatctcaatctgtggctttttctaccgattacggcgtttcatggcatcggtatgag
aataacccgcttctttccgtgccaccgaagagagaactgagtactggatggcgagatccg
ttcgtctcaccttggacgacgctttcgagatttctgggcgtcgatgaagcgacggactat
atgatgattgcttctggtgagcgagggagaggttcggcacttcatctatactcttcaaat
aatcttcttggctgggatttatgctcaacgattctcgaagtagaaaccaatactccggtc
tcgccgacgagctcgtttatttggggaatgaacttcgaatgtgcgagctttttcaatatt
ggcgagagcaattacattcttgttggaatcgaggaagatatccctagcacaagacacaat
cggcacttgaccctatggctacgaggagagtttgttctcgaaaatggaaaaccaaagttc
aacattctcagccatggcatgcttgatttcggtatcctgtatgcaatccacatattccgc
gacgctgaaggacgactactgcaattgggatgggcagatgagtccgcaaacgcaaagaca
atcaaacagcaaggttgggctggatgtatagctcatccaagagagctctacgagatttca
aaaccaatcgctgacagtatttccgaggaggatatctggtatgtcgacgaaaaagctggg
agaatgacggcccttggtataagaccagcccctcaaatttcccaagtccgcgattcaaga
acacagatcccacttgagaatttcaaaagcatacgctctaagaattacgagattaaaaca
accttcaaaaagccaaccggcacagaagaattcacattcaacgtccgtcaatctcccaac
aaagaagaactcactaaaatcatcttcgacctcgcaaactccaccatatccgtcgatcgc
agcaaatcctccctcgaaaacctaggaagtagcttcaccgaaatagggcgcttcaccctc
cttccagatgaagatcttgatatccggttatttgtcgataactcaattatcgaggtttac
gcaaatgatcggtttgctttgacatcgaggatatatccgagtttagagtcgctgggagtt
gattatgattttggcgggtttgaggaggagaatgtggggttttggtgctgggaagggttg
aaggatgcttggcctacgagaagggagggctctgttgagtcttcggctgaagatgtgact
gtagatgaaaagggggtggtgcaggttatggagagacctattgttgttgtttga

DBGET integrated database retrieval system