KEGG   Glarea lozoyensis: GLAREA_04589Help
Entry
GLAREA_04589      CDS       T04883                                 

Definition
(RefSeq) FAD/NAD(P)-binding protein
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
glz  Glarea lozoyensis
Pathway
glz00330  Arginine and proline metabolism
glz00410  beta-Alanine metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    GLAREA_04589
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GLAREA_04589
Enzymes [BR:glz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     GLAREA_04589
    1.5.3.16  spermine oxidase
     GLAREA_04589
    1.5.3.-  
     GLAREA_04589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Shikimate_DH FAD_binding_3 Pyr_redox Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 19463644
NCBI-ProteinID: XP_008085157
UniProt: S3DMT8
Position
Unknown
AA seq 540 aa AA seqDB search
MAPQSFLGRFAFLCVCLPWLFGSSLATPTPPKNGTCTKTKVVILGAGMTGIAAAQALYNA
SVTDFIIVDVNDYIGGRVKHTTFGKNASTSEPYVVELGANWVQGLVSPEGPENPIWTLAK
KWGLENTYSNYSMIQTYDQHGAADFAGLLDDYETAYATVEQDAGTILTDNLQDRTMRTGL
SIADWKPKKNMQAQAAEWWEFDWEYSYSPDQSSQTFSIINFNDTFYQFSDENNFVIDQRG
FNYMIEGEAYTFLTPNDTRLRLSTNVTSITYSSYGVIIGMADGSCIQADYAVCTFSLGVL
QNDVVTFDPVLPAWKQASIEGMQMGTYTKIFFQFPPSADGTFFWEHGDDAATQFFLYADP
TERGYYPVFQSLNAPDFIPGSGIFFVTVVYAQSYRAEQQSNDATKAEVMEVLRTMFGSDI
PDPIDFMYPRWSTEPWAYGSYSNWPPGLSLETHQNLRANLGRLWFAGEATSVGYFGFLQG
AYTEGQFVGNTIAGCLGNNKTICKNEASYSKIRGCTTSERQLTANNGWFVSSMQTFGFEE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcaatcgtttctgggcagatttgctttcctttgtgtctgtctgccgtggctg
tttggctcatcgttggcgacaccaaccccgccgaagaatggaacatgcacaaagactaag
gtggtcattttgggtgcgggcatgacgggaattgccgctgcgcaagctttatataacgct
tcagtaacagactttatcattgtggacgtcaacgattatattgggggtagagtcaagcat
accacatttggaaagaatgcttcgacaagtgagccatatgtagtggaactcggggccaat
tgggtccaaggtctagtttctccagagggaccagaaaatccaatttggactttagcgaag
aaatggggtttagaaaatacgtactcgaattattctatgattcagacctatgaccagcat
ggagctgcagatttcgctggccttctagacgactacgagactgcatatgcaacagttgag
caagatgctggaacgattctaacagacaatctccaagatcgaacgatgaggaccgggttg
agcatcgcagactggaagccgaagaagaatatgcaagcacaagctgccgaatggtgggaa
tttgattgggagtattcatattctccagatcaatctagtcagacgttctcgattattaac
ttcaatgacactttctaccaattcagtgacgaaaacaattttgtgatcgaccaacgtggt
ttcaattacatgattgagggcgaggcatacacatttctcaccccaaacgatacgcgttta
cgactctccaccaatgtcactagtattacctacagttcttatggtgttatcattggtatg
gctgatggatcttgtattcaagcggactacgcagtctgcacattcagccttggtgtcctt
caaaacgatgttgtaaccttcgatccggtcttacctgcttggaaacaggcaagtatcgag
ggtatgcaaatgggaacctacactaaaatattcttccaattccccccgtctgcagacggg
accttcttctgggaacatggcgacgatgcggcaactcaattctttctttacgccgatccg
acagaacgtggatactatcccgtttttcagtcactaaacgctccagacttcatccctggt
tctggtattttcttcgttacggtggtttatgcacaatcatatcgcgccgaacagcagtct
aatgatgccacaaaggcagaggtcatggaagttctcagaactatgttcggaagtgatatt
cctgatccaattgactttatgtatccaagatggagtacagagccttgggcatatggaagt
tactctaactggcctccgggactgagtcttgaaacccaccaaaatctccgagcaaattta
gggagactgtggtttgcaggagaagcaactagcgttgggtattttgggttcttgcaagga
gcatacactgaagggcaattcgttggtaatactattgctggttgcttgggcaacaacaag
actatttgtaagaacgaggcctcatattctaagataagagggtgtacaacaagcgaacgg
cagttgaccgctaataatggttggttcgtatcaagtatgcaaacctttggattcgaagaa
tag

DBGET integrated database retrieval system