KEGG   Glarea lozoyensis: GLAREA_06008Help
Entry
GLAREA_06008      CDS       T04883                                 

Definition
(RefSeq) Aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
glz  Glarea lozoyensis
Pathway
glz00010  Glycolysis / Gluconeogenesis
glz00030  Pentose phosphate pathway
glz00051  Fructose and mannose metabolism
glz00680  Methane metabolism
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
glz01130  Biosynthesis of antibiotics
glz01200  Carbon metabolism
glz01230  Biosynthesis of amino acids
Module
glz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
glz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
glz_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLAREA_06008
   00030 Pentose phosphate pathway
    GLAREA_06008
   00051 Fructose and mannose metabolism
    GLAREA_06008
  09102 Energy metabolism
   00680 Methane metabolism
    GLAREA_06008
Enzymes [BR:glz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     GLAREA_06008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-GeneID: 19465062
NCBI-ProteinID: XP_008079613
UniProt: S3DLR1
Position
Unknown
AA seq 290 aa AA seqDB search
MPKSMKDNRAVRMLREAEEGGYGIIGVVSYNLETITAVVRAAEKKRSPAQILLFPWALHY
SPLLIHLAIAAVRTATVPIVLHMDHAQSEDEIIAASDYDFDSIMVDMSHYEKEENLEKTE
RITKMLHGKGIATEAEPGRINGGEDGVKDTGDLEGLLTTGEEAARFVSTGIDFLAPAFGN
VHGNYGGIENIRLEYDRLTSIREACKGKAQMVLHGTNTFPDETTQKCIKGGMTRINVNDL
VLSKYNEYVKENTGKVPLTELMGKGTDLIQELCEYQMDVMGSSGKGEVRY
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaatcaatgaaagacaacagagcagttcgaatgctccgagaagcagaggaagga
ggctatggaatcatcggtgtcgtttcctacaacctcgaaaccataacagccgtcgtccgc
gccgccgaaaaaaagcgctcgccagcccaaatcctcctcttcccctgggccctccactac
tcgcccctcctaatccatctcgccatcgccgccgtgcgtaccgccaccgtgcctatcgtc
ctgcacatggaccacgcgcagtccgaagacgagatcatcgcggcgtcggactacgatttc
gattccatcatggtcgacatgtcgcactacgaaaaggaagagaatttagaaaagacggag
cggatcacgaagatgttgcatgggaagggtattgcgacggaggcggaacccggacggatt
aatggcggggaggatggggttaaagatacgggggatcttgagggattgcttacgaccggg
gaggaggcggcgaggtttgtgagtaccgggattgactttttggcgccggcttttgggaat
gtgcatgggaattatgggggcattgagaatattaggttggagtatgatagacttacatcc
atccgcgaagcctgcaaaggaaaagcccagatggttctccacggcaccaacaccttcccc
gacgaaacgacccagaaatgtatcaaaggcggtatgaccaggattaatgtcaatgatctc
gtcttatctaaatacaacgaatacgtgaaggagaatacggggaaagtgccgcttactgag
ttaatggggaagggcacggatttgattcaggagttgtgtgagtaccagatggatgttatg
gggagtagtgggaagggtgaggttaggtattag

DBGET integrated database retrieval system