KEGG   Glarea lozoyensis: GLAREA_07493
Entry
GLAREA_07493      CDS       T04883                                 

Definition
(RefSeq) FAD/NAD(P)-binding protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
glz  Glarea lozoyensis
Pathway
glz00910  Nitrogen metabolism
glz01100  Metabolic pathways
Module
glz_M00531  Assimilatory nitrate reduction, nitrate => ammonia
glz_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    GLAREA_07493
Enzymes [BR:glz01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     GLAREA_07493
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Fer2_BFD Rieske NIR_SIR_ferr Rubredoxin_C Amino_oxidase K_oxygenase
Other DBs
NCBI-GeneID: 19466546
NCBI-ProteinID: XP_008080372
UniProt: S3D3L2
Position
Unknown
AA seq 1115 aa
MSGNWQPQIPIQEIKAGPIENGPDGVVGSDKVSNEGERKKIVVVGLGMVGISFIEKLMKL
DAKRREWDIIVIGEESHLAYNRVGLTSFFAHRKVENLYLNPKEWYSNCPEGSLNYHLNTK
VTEIHLNEKLVSCSSGETVPYDVLVIATGSDALLPRHTPGHDAKGVFVYRTIEDLEKLIE
FGAKNKGTVGAVVGGGLLGLEAANAMMDLENYEKVKLIERNRWVLSRQLDSDAGGLVVEQ
VRELGLDVLLGKRVGKIEVTEDNYVKGVVFEDGERMDCSTICFAIGIKARDELARKAGIK
CADRGGGIVVDGELKTSAPDVYAIGECASWENQTFGLIAPGIEMADVLSFNLTQAKDHAY
RSFKRPDLSTKLKLLGVEVASFGDFFADRDGPKHLPLRAAKKKEGSPDALRKLTNGTPPP
PVKALTYKDPFQNVYKKYLFSLDGKYLLGGMMIGDTKDYVKLVPMVKNQKMLDVPPSQFI
LGASKEGDEGGDDLDDDTQICSCHNVTKGDVCSVVKDGSCKSIGDVKSCTKAGTGCGGCM
PLVTSIFNSQMKAMGNEVKNHICPHFNYSRADLYNIISVKQLKTLQEVMKEAGNDPESQG
CEACKPSIGSIFSSLYNKHVMAKPLMGLQETNDRFLGNIQRNGTYSVVPRVSAGEITPEK
LIVIGNVAKKYNLYTKITGGQRIDMFGAKKQDLLAIWKELVEGGMESGHAYAKSLRTVKS
CVGTTWCRYGIGDSVGMAVRLEERYKSIRSPHKMKGGVSGCVRECAEAQNKDFGLIATEK
GFNLFVGGNGGASPKHSELLAKDVPPDDIIPIIDRYLMFYIRTADKLQRTARWLEALPGG
IKYLREVILEDKLGICASLEAQMEELVGTFFDEWAEAINNPEIAKKFQQFDNTKDSLETM
DTEEDRGQTRPVYWANESAKVDFRNTKWTSLTWQPMIEASHFVGADDTPNGISANVKRGD
TQLAIFKVRGKYLASQQMCPHKRAFVLSDGLIGDSKDKLWVSCPFHKRNFELNGEQAGRC
QNDEEVSIATFPVEERDDGMVYLKLPPVHELDGVLGTKKWSVKKGESGASPFEKLDRKIG
VNGTRMKGRKPLEAKRQLHAGAVKAGGGDGVDIDW
NT seq 3348 nt   +upstreamnt  +downstreamnt
atgtcaggtaattggcagccacagattccgatccaggaaatcaaggctggaccgattgag
aatggtccagatggcgttgttggatcggataaagtgagtaatgaaggggagaggaagaag
attgttgtggtggggttggggatggtggggattagttttattgagaaattgatgaagctg
gacgcgaagagacgagaatgggatatcatagttattggagaggaatcacatcttgcgtac
aatcgtgtgggattgacgagtttcttcgcacatcgaaaagtcgagaatctatatctcaat
cctaaagaatggtactcaaattgccccgaaggatccttaaactaccatttgaacaccaaa
gtaaccgaaatccacctcaacgagaagctcgtctcctgctcatccggggaaaccgttcct
tatgacgttcttgtcattgctaccggctccgatgcgcttcttccacggcatacgcctggc
cacgatgcaaagggtgtattcgtataccgaacgatcgaagatctagaaaagcttatagag
tttggggcaaagaataaggggacggttggtgcggtagttggtggaggtcttcttggactc
gaagctgcgaacgccatgatggatttggagaattatgaaaaagtcaaactgattgaaaga
aatcgatgggtgttaagtcgacagttagactcagatgctggcgggcttgtcgttgaacaa
gtgagagaattgggactggatgtcttgttaggcaagcgagttggcaagattgaggtcacc
gaggataattatgtgaagggtgttgtttttgaggatggggagagaatggactgctcgacg
atctgctttgcgatcggtatcaaggctcgcgatgagctggccaggaaagcgggtatcaaa
tgcgccgatcgtggaggtggtatcgtggttgatggagagttgaagactagcgcaccagat
gtttatgcaattggagagtgcgcaagctgggagaaccagacttttggtcttatcgctccg
ggcattgaaatggcggacgtcctctcattcaaccttactcaagccaaagatcatgcatat
cgatcattcaagcgaccagatctcagtaccaaattaaagcttttaggtgttgaagttgcg
agttttggagatttcttcgcggatcgagatggaccaaaacacctcccacttcgagcagcc
aagaaaaaggaaggaagtcctgatgctctgcgaaaactcaccaacggtactccaccaccg
ccagtcaaggctttgacatacaaagatccattccagaatgtctacaagaaatacctgttc
tcactggatgggaaataccttcttggtggtatgatgattggagataccaaggactacgtg
aaactggttccaatggtaaagaaccagaagatgcttgatgtcccacccagtcaattcatc
cttggagcgagcaaagaaggagacgagggtggagatgaccttgacgacgatacacagatt
tgctcttgccacaacgtcacgaaaggcgatgtctgctcggttgtcaaggacggaagctgt
aagagcattggtgatgttaagtcctgtaccaaagccggaactggatgtggaggttgtatg
cccctggtcaccagcattttcaacagccagatgaaagctatgggcaacgaagtcaagaac
cacatttgccctcatttcaactattctcgagctgatttgtacaacatcatctccgtcaag
caactcaagactttacaagaagttatgaaagaagctggaaatgacccagagagtcagggt
tgtgaggcttgcaaacctagcattgggtctattttctcatcactttacaacaagcatgtg
atggctaagccattgatgggtctgcaagaaactaatgatagatttttgggtaacatccag
agaaacggtacttactccgtggttccacgagttagtgctggtgaaatcacgcccgaaaag
ctgattgttatcggaaatgtggcaaagaaatacaacctctacacgaagatcactggaggt
cagagaatcgacatgttcggtgcaaagaagcaagatcttctggctatctggaaagagttg
gtggaaggtggtatggagtctggacacgcatacgcgaagtcattgcgaacagttaaaagc
tgtgtgggtactacctggtgtcgatatggtatcggagacagtgtgggtatggctgtgcga
cttgaagagagatacaagagtattcgaagtccgcataaaatgaagggtggtgtcagtggt
tgtgtcagagaatgtgcagaggcgcagaataaggatttcggtctcatcgcaacagaaaaa
ggattcaacctcttcgtcggtggtaatggaggagcatctccgaaacacagcgaacttctc
gccaaagacgtacccccagatgatatcatccccatcatagatcgctacctaatgttctac
atccgcaccgccgacaaacttcaacgtaccgctcgctggcttgaagcccttccaggtgga
atcaagtacctacgcgaagtcattctcgaagacaagctcggtatctgcgcctctttagaa
gcacaaatggaagagctcgtcggtaccttcttcgacgaatgggctgaagcgatcaacaac
cctgaaatcgcaaagaaattccaacaattcgataacaccaaagactctctcgaaaccatg
gatactgaagaagatcgtggacaaaccagacccgtttactgggccaacgaaagcgccaaa
gtcgatttccgcaacaccaaatggacgagtctcacctggcaacccatgatcgaagcctcc
cacttcgtcggcgcagacgacacgcccaacggcatctccgccaacgtcaagcgcggcgac
actcaactcgcgatcttcaaggtccgcggcaaatacctcgcctcgcagcaaatgtgtcct
cacaaacgcgccttcgtcctctccgacggcctcatcggcgactccaaagataaactctgg
gtctcctgtccgttccacaagcggaatttcgaactcaatggcgaacaagctggacgatgt
cagaatgatgaggaggtcagcattgcgacgttccctgtggaggagagggatgatgggatg
gtttatttgaagttgccgcctgtgcatgagcttgatggggtactagggactaagaagtgg
agtgtgaagaagggtgagagtggcgcttcgccgttcgagaagttggataggaagattggg
gttaatgggacgaggatgaaggggaggaagccgttggaggcgaagagacagttgcatgct
ggggctgttaaggcggggggtggggatggggttgatattgattggtag

DBGET integrated database retrieval system