KEGG   Glarea lozoyensis: GLAREA_08319Help
Entry
GLAREA_08319      CDS       T04883                                 

Definition
(RefSeq) PLP-dependent transferase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
glz  Glarea lozoyensis
Pathway
glz00350  Tyrosine metabolism
glz00360  Phenylalanine metabolism
glz00380  Tryptophan metabolism
glz00901  Indole alkaloid biosynthesis
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    GLAREA_08319
   00360 Phenylalanine metabolism
    GLAREA_08319
   00380 Tryptophan metabolism
    GLAREA_08319
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    GLAREA_08319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:glz04147]
    GLAREA_08319
Enzymes [BR:glz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     GLAREA_08319
    4.1.1.105  L-tryptophan decarboxylase
     GLAREA_08319
Exosome [BR:glz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GLAREA_08319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 DUF5040
Motif
Other DBs
NCBI-GeneID: 19467368
NCBI-ProteinID: XP_008088555
UniProt: S3CD50
Position
Unknown
AA seq 526 aa AA seqDB search
MDSKQFKEAATSAIDEIVNYYDTIQDRRVVSNVEPGYLKKLLPDGPPENGEPWADIQRDI
ETKIMPGLTHWQSPNFLAFFPASSSFPGMLGELYSAAFTAPAFNWICSPAVTELETVVLD
WLAKLLNLPDCYLSSSHGGGVIQGSASEAIVTTMVAARDKYLRETTSHLSGTELEDAVAH
KRSKMVALGSDQAHSSTQKAAQIAGVRYRSVPAAKSNEFAMTGSDLEEVLKQCKAQGLEP
FYLTTTLGTTSTCAVDDFDSIANTLADYAPPDVSGEIWVHVDAAYAGAALVCPEYHHLTA
AFKHFHSFDMNMHKWLLTNFDASCLYVKKRKDLIDALSIMPSYLRNEFSESGLVTDYRDW
QIPLGRRFRSLKIWFVLRTYGVNGLRAHIRNHIELGEGFANLIKSNPDLFKMFTLPSFAL
TVFTVLSDSKDQKERNEVTKEVYELVNSRGQIYITSSLVAGVYVIRVVSANPKAEEKYLK
KAFEILVATTEEVRAGRIKKIENDVVTMDIKGVGEAAITNSNGRPS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaagcagttcaaggaagctgctacatcggcgattgatgagattgtcaattac
tatgataccattcaagatcgacgagtggtatccaacgtcgagccaggatatctcaaaaag
ctccttcctgacggaccgccagaaaatggagagccatgggcagatatacagagggacatt
gagacgaagatcatgcctggtttgacccactggcaatccccgaactttctggcattcttc
ccagcttcttcttcgtttcctggcatgttgggagagctatactctgccgcattcactgcc
ccggcgttcaattggatatgctctcctgctgtaacagaactcgagactgttgtcttggac
tggcttgcgaaactcctcaatctgccggattgctacttatcgagcagtcatggtggaggt
gtaatccaaggttcggcgtcagaagctattgtcactactatggtagctgcgcgtgacaag
tatcttcgtgagacaacttcccacttatccggcactgagctcgaagatgctgttgcacat
aagcgaagtaagatggttgcattagggagcgaccaggcgcatagctctacacaaaaggca
gcacagatcgcaggtgttcgatatcgatccgtccctgctgccaaaagtaatgagtttgcg
atgacaggttctgacctggaggaggtgctgaagcaatgcaaggcgcaaggtctagagcca
ttttacctcaccaccaccttaggaacaacttcaacatgcgccgtggatgatttcgactct
attgcgaacaccctcgccgattacgcgcctccagatgtctcgggagagatttgggttcat
gttgatgctgcctacgctggagctgccctcgtctgtcccgaataccaccaccttaccgca
gcctttaaacacttccattctttcgatatgaatatgcacaaatggctgctcacaaacttc
gatgcatcatgtttgtacgtcaaaaagagaaaggacttgattgatgcgctctcaatcatg
cccagctatcttcgaaatgaattttcagaaagtggtctggtcacagattaccgtgactgg
cagattccgctaggtagacggttccgaagtctcaagatttggttcgttttgaggacatat
ggcgttaatggtttgcgagctcacattcggaatcatattgagcttggcgagggctttgca
aatctgatcaagtcgaacccagatttgtttaagatgttcactctgccgtctttcgctttg
accgtctttacagtcctctctgattccaaagatcagaaggaaagaaatgaagttacaaaa
gaagtttatgagttggtcaatagtcggggacagatttacatcacttcgagtcttgtggct
ggtgtttacgtcattagggtcgtgagtgcgaatccaaaagcggaagagaaatatctcaag
aaagctttcgagatattggttgccacgacagaagaggttcgtgctggtaggataaaaaag
atcgagaatgacgtggtaacgatggatatcaaaggtgttggagaagctgctattactaac
agtaatggccggccaagctaa

DBGET integrated database retrieval system