KEGG   Glarea lozoyensis: GLAREA_09874Help
Entry
GLAREA_09874      CDS       T04883                                 

Definition
(RefSeq) Glycosyl hydrolase family 6, cellulase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
glz  Glarea lozoyensis
Pathway
glz00500  Starch and sucrose metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLAREA_09874
Enzymes [BR:glz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     GLAREA_09874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-GeneID: 19468921
NCBI-ProteinID: XP_008084661
UniProt: S3DQK3
Position
Unknown
AA seq 395 aa AA seqDB search
MKYSFGLVALAAFATAAPTEVEKEAAKIAPRAACTTAVKLAAGSNPFSGKKFYANEYYAG
EVAAAAAQMSDSSMAAKAAKVGQVGSFLWIDTIARVPLVADTLSKVACGEIAQIVVYDLP
GRDCAAKASNGELAVGEISRYKSEYIDPIAAAIKANPNVAVALLIEPDSLPNLVTNANLT
TCQASKSGYEEGVAYALKTLNLPNVAMYIDAGHGGWLGWDANLKPGAEGIAKVYKAAGSP
KQVFGFATNVAGWNAFQQTPGEFSTATDAKYNKCQDEKRYVNAFAPLLKTAGMPNHAIVD
TGRNAVTGLRLAWGDWCNVIGAGFGVRPTTTTNDALVDAFVWGKPGGESDGVSDPDADRY
DSFCGHEDAFKPSPQAGQWNQAYFEQLLANAKPPF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagtattcttttggattagtagcccttgcggcttttgcaactgcagcaccaacagag
gttgagaaggaggccgccaagatcgcaccacgcgctgcttgcactactgctgttaagctt
gctgctggttccaaccctttctccggaaagaagttctacgccaatgagtactatgctgga
gaagttgccgctgccgcagcacaaatgagcgattcttcaatggctgctaaggccgcgaag
gttggacaagttggaagtttcttgtggatcgataccatcgccagagtcccactggttgcc
gatactcttagcaaagtcgcttgtggagagattgctcagatcgtcgtctacgatcttcca
ggacgtgattgcgccgccaaggcctccaacggagagcttgctgttggagagatctccaga
tataagtcagagtacattgacccaattgctgctgccatcaaggccaacccaaatgttgcc
gtggccttgttgattgagcctgattcccttcctaacttggttacaaatgccaacttgacc
acctgccaagcatccaaatctggctacgaggagggtgtcgcatacgcattgaagactctc
aatcttccaaacgttgccatgtacatcgatgccggtcacggaggatggctcggatgggat
gccaaccttaagcctggagctgagggtattgccaaggtctacaaggctgccggttcccca
aagcaagtctttggtttcgctaccaatgttgccggatggaacgcattccaacaaactcca
ggagaattctccaccgcgactgacgccaagtacaacaagtgccaggacgagaagcgatat
gtcaacgccttcgctcctctcctcaagaccgccggtatgcccaaccacgccatcgtcgat
accggacgcaacgccgtcactggtctccgtctcgcatggggagattggtgcaatgtcatc
ggagccggtttcggtgtccgaccaaccaccactaccaacgacgctctcgtcgacgccttt
gtctggggcaagccaggaggagagtctgacggtgtcagcgacccagatgctgatcgttat
gattctttctgtggtcacgaggatgcattcaagccatccccacaagctggtcaatggaac
caggcctacttcgagcagctccttgccaacgccaagccaccattctaa

DBGET integrated database retrieval system