KEGG   Glarea lozoyensis: GLAREA_12251Help
Entry
GLAREA_12251      CDS       T04883                                 

Definition
(RefSeq) PLP-dependent transferase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
glz  Glarea lozoyensis
Pathway
glz00260  Glycine, serine and threonine metabolism
glz01100  Metabolic pathways
glz01110  Biosynthesis of secondary metabolites
glz01130  Biosynthesis of antibiotics
glz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GLAREA_12251
Enzymes [BR:glz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     GLAREA_12251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 19471292
NCBI-ProteinID: XP_008081224
UniProt: S3D0W3
Position
Unknown
AA seq 401 aa AA seqDB search
MSLAEAHEETKGLSGTSDLAPTQEQHKRINAWSGPGPAAFDFRSDVVTTPTPSMLKAISN
TSLLDDVFMEDPTTNDLESYMAERTEQEAGLFVLSGTMGNQLALRSHLTQPPHSVLCDYR
AHILVWEAGGVATLSGALVNGVVPKNGVYLTLEDIKENVVLGDDVHAAPTRVISLENTLG
GTIMPLEEVRKISAFAKEHDIKLHLDGARIWEAVVAGAGSLPDYCKEFDSVSLCFSKGLG
APVGSVLVGSKKLIKQARWVRKSIGGGLRQPGVVTAAARVAVDETFGKSPNGEDGILKKS
HGTAKRIAEIWTRLGGKLAQPTETNMVWFDLRDANCSGNGFVEIGKQHGLRLLAGGRLVV
HYQISNEAVQKLELALKDIVAKKGQNGHTDIAAKVGEKAYR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttggcagaggcacacgaagagacgaagggtttgagtggcacgtcagatcttgct
ccaacgcaagagcagcacaaaagaatcaatgcctggtctggtcctggcccagccgccttc
gatttccggagtgatgttgtgacaacacccacaccgtccatgctgaaggcgatttcaaac
acctccctcctcgacgatgtcttcatggaagatcctaccacgaacgatctcgaatcatac
atggccgagcgaaccgagcaagaagcaggtcttttcgtcctgtcagggaccatgggaaac
cagcttgctctgcgatcacacctgacgcaaccccctcactcggtgctgtgcgactatcgg
gcgcatattttagtctgggaggctggcggggtggccactttgtcaggcgcattagtgaac
ggagttgtgccaaagaatggagtttacttgacattggaagatatcaaggagaacgtcgtt
cttggagacgatgttcatgctgcaccgacaagggtgatatcccttgagaacactcttggg
ggtaccatcatgccattagaggaagtgagaaagatatccgcctttgcaaaggaacatgat
atcaaactgcatcttgatggcgctagaatctgggaagccgttgtggcaggtgctggctca
ctcccagattactgcaaagaatttgacagtgtcagtctttgcttctcaaagggtcttgga
gctcctgttggaagtgtccttgtcggcagtaagaagctgatcaagcaagcccgatgggtt
aggaagagtattggtggtggcctaagacaaccaggcgtggttaccgcagccgctcgggtc
gcggtagacgaaacttttggcaagtctccaaatggtgaagatggcattctaaaaaagagc
cacggaaccgcaaagagaattgcagagatttggacccgtctcggtggtaagctggcacaa
ccgaccgaaacaaatatggtgtggtttgatctccgtgatgccaattgctccggcaatggt
ttcgtggagattgggaagcagcatgggctccgactacttgctggtgggcggttggttgtc
cattaccagatcagtaatgaagcagttcaaaagcttgagcttgcgttgaaggacattgta
gccaagaaaggccagaacggccatacagatattgcagccaaagttggcgagaaagcatat
agatga

DBGET integrated database retrieval system