KEGG   Glarea lozoyensis: GLAREA_12517Help
Entry
GLAREA_12517      CDS       T04883                                 

Definition
(RefSeq) Nucleotidylyl transferase
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
glz  Glarea lozoyensis
Pathway
glz00760  Nicotinate and nicotinamide metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GLAREA_12517
Enzymes [BR:glz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     GLAREA_12517
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     GLAREA_12517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like TFX_C
Motif
Other DBs
NCBI-GeneID: 19471558
NCBI-ProteinID: XP_008081490
UniProt: S3DIB1
Position
Unknown
AA seq 284 aa AA seqDB search
MGSVTPNGTDVAQQSNGTHPQAQTQTLPKPTRPITSRTPYSFLHNKLKRRMTNPEKTPLV
LVACGSFSPISILHLQMFEMAEKYANKKTNFEVVGSYLSPVSDAYKKPSLVPAHHRLVMC
SLAVEDTTDIMVDSWEALRHDEAGEPVYSTTIDALRHFDQAINEEMGGIQTADGIYKKAQ
IALLVGADVAVTMGDPKVWDPADLEQILGDYGMFVVERPAQTDINTALKPLMKYDKIWQV
NSFENEVSSTRIRAQIKNGEDVFDLPPKVIDYIRSHGLYNGVPA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgtaacgccgaatggaacagatgtcgctcagcaatcgaatggaacacatcca
caagcacaaacgcagacactgccgaagcctacgaggccgataacatcgcgcacaccatac
agctttctgcacaacaaattgaaacggcgcatgacgaatccggaaaagacccccctcgtt
ctcgtcgcatgcggcagcttctcgcctatctccatcctccacctccaaatgttcgaaatg
gccgagaagtacgccaacaagaagacgaatttcgaagtggtcggcagttacctcagtccc
gtcagtgatgcctacaagaagccgtctttggtgccggcgcatcatcgcctggtgatgtgc
tcattggcggtggaggacacaacggacatcatggttgattcatgggaagcattacggcac
gatgaggctggtgagccagtttacagtaccacgattgatgctttgcgacatttcgaccag
gcgatcaatgaggaaatgggaggcatacaaaccgcagacgggatttacaagaaggcgcaa
atagctctactcgttggcgccgatgtggctgtgaccatgggcgatccaaaagtgtgggat
cctgcggatctcgagcagattcttggagactacggcatgtttgtggtggaacggcctgct
cagacggacatcaacaccgctctcaagcctttgatgaagtacgacaaaatttggcaggtc
aattcattcgagaacgaagtaagctcaacgagaatccgcgcccagatcaagaatggggaa
gatgtctttgatcttccacccaaggtcattgattacatacggtcgcatgggttgtacaat
ggggtgcctgcgtaa

DBGET integrated database retrieval system