KEGG   Granulicella mallensis: AciX8_0720Help
Entry
AciX8_0720        CDS       T01664                                 

Definition
(GenBank) urate oxidase
  KO
K00365  urate oxidase [EC:1.7.3.3]
Organism
gma  Granulicella mallensis
Pathway
gma00230  Purine metabolism
gma01100  Metabolic pathways
gma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AciX8_0720
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AciX8_0720
Enzymes [BR:gma01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     AciX8_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Uricase DUF5055 FolB Glyco_hydro_9
Motif
Other DBs
NCBI-ProteinID: AEU35069
UniProt: G8NRV6
Position
complement(832655..833515)
Genome map
AA seq 286 aa AA seqDB search
MPVKLVSNRYGKSRVRLMRVTRHEQHHDLDEWTVQVLLTGDFDTAHTLGDNAKILPTDTM
KNTVYHVARESKATSMEDYAKELIDFLLGRNPQAESVEVVVESTLWKRLTVDGQPYPTAF
MRGSDERQTTTVSRQQGQAFAITSGLERLTVLKTAQSGFMGFIKDSLTTLPETSDRLFGT
AVKAEWPYTKAAIEAGIDFNKVRSHLRDILITTFAKHDSLSVQQTLYAMAEGALHHTDII
DEVYMLMPNKHNLLVDLGRFGQENPNHIFVPTDEPHGTIEATVRRV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaaaacttgtctccaatcgttatggcaaatcgcgcgtgcggctgatgcgtgtg
accaggcatgagcagcatcacgatctcgacgagtggacggtgcaggtcctgctcaccggc
gacttcgacactgcgcacactctcggcgacaacgcgaagattcttccgaccgacacgatg
aagaacacggtctatcacgtcgcgcgcgagtcgaaggccaccagcatggaggactacgcc
aaggaactcatcgacttcctgctgggacgcaacccgcaggccgagagcgtcgaggtcgtc
gtcgagtcgacgctgtggaagcggcttaccgtcgatggccaaccttatccgacggctttc
atgcgcggatcggacgagcggcagaccacaacggtttcgcggcaacaaggccaggccttc
gcgattaccagcgggctcgagcggctcacggtgctcaagaccgcgcaatccggctttatg
ggcttcatcaaagactcgctgacgaccctgcccgagaccagcgaccggctgttcggcaca
gccgtcaaagccgaatggccttacacgaaagctgctattgaagccggcatcgacttcaac
aaggttcgcagccatctgcgggacatcctcatcacgaccttcgcgaagcacgattcgctg
tcggtgcagcagacactctatgccatggccgagggcgcgctgcatcacaccgacatcatc
gacgaggtttacatgctgatgccgaacaagcacaacctgctggtcgacctgggccgcttt
gggcaggagaatccaaatcacatcttcgttccaaccgatgagccacacggcaccatcgaa
gcaaccgtacggcgtgtctga

DBGET integrated database retrieval system