KEGG   Granulicella mallensis: AciX8_1355Help
Entry
AciX8_1355        CDS       T01664                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
gma  Granulicella mallensis
Pathway
gma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gma00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AciX8_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Haem_bd Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome_C554 Cytochrome-c551
Motif
Other DBs
NCBI-ProteinID: AEU35698
UniProt: G8NZY2
Position
1575168..1575941
Genome map
AA seq 257 aa AA seqDB search
MRHSRGIIALAAAVAVIGGLGLVHPFGNPRVEPGKGLDTLLVHASMPADAKKILISKCAD
CHSNETRWPVYALLAPGSWLIEWDIVEARKKLNLSSWDQMAADAQEQMIGEIIHEAKAGE
MPPSQYRLLHWKSQLTTQDVATLSSMKTSEATQASTSSSGDAARGKMVFEKRCMGCHTME
TDREGPRLAGVFGRKAGSVAGFNYSEGLKKSGITWDEASLEKWLTDPDMMVPDNNMSIGV
PKAQERSDLIAYFKQFK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgagacattcacgtggaatcatcgctctggccgcagccgtggctgtcatagggggattg
gggcttgttcatccgtttggtaacccacgtgtcgagcctggaaaggggctcgacacgctg
ttggtgcacgcaagtatgcctgctgacgcgaagaaaatcctcatcagcaaatgtgctgac
tgtcactcgaatgaaacccggtggccggtgtatgcactcctggcacccggatcgtggctg
atcgagtgggatatcgtagaggcgcgcaagaagctgaatctctcatcctgggatcagatg
gctgccgatgcacaagagcagatgatcggagagatcattcacgaagcgaaggctggtgag
atgccgccgtcgcagtaccgtcttcttcattggaaatctcaactgacaactcaggatgtg
gcaacactctcgagtatgaaaacgagcgaagcaacgcaagcgagtacaagcagctctggc
gatgccgcgcgcggaaagatggtgtttgaaaagcggtgcatgggctgccacacgatggag
acagatcgggaaggaccgcggctggccggtgtatttggaagaaaggccggaagcgtggcg
ggattcaactactccgaggggctaaaaaaatctggcattacctgggatgaagcttcgttg
gagaagtggctcaccgacccggacatgatggtgccggacaacaatatgagcatcggtgtt
ccgaaggctcaggagcggtcggatttgattgcctatttcaagcaatttaaatag

DBGET integrated database retrieval system