KEGG   Granulicella mallensis: AciX8_1948
Entry
AciX8_1948        CDS       T01664                                 

Definition
(GenBank) Uncharacterized conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
gma  Granulicella mallensis
Brite
KEGG Orthology (KO) [BR:gma00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gma02044]
    AciX8_1948
Secretion system [BR:gma02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AciX8_1948
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEU36279
UniProt: G8NST6
Position
2285519..2286022
AA seq 167 aa
MPIIEVKRQSVRTAVRKVPTSTTAIPMPMTAERVGTELRSDSEEPVVVESLEDAFAKFKP
GLKFRSAQREDGVTFQADLRFESVKDFEPANLMARREIKAEDGSVTSPRNDLADLKNNID
LLYRLKDRWRLPAVRRAWSDPQERKQMIEALDKLREELEKVSERETK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgccgattatcgaggtcaagcgacaaagcgtacggactgccgtacgaaaggtgccgacc
agcaccactgcgattcccatgccgatgacggcggaacgcgtaggtacggagttgcgcagc
gatagtgaagagccggtagtcgtggaatcgctcgaagatgcctttgcgaagtttaagccg
gggttgaagtttcgcagcgcgcagagagaggacggcgttacctttcaggcggacctgcgc
tttgaaagcgtgaaggatttcgagccagcgaacctcatggctcggcgtgagatcaaggcc
gaggacggatcggtaacgtctcccagaaacgatctcgccgacctcaagaacaatatcgat
ctgctgtatcggctcaaggatcgctggcgtttgccggcagtgcgccgcgcgtggtctgac
cctcaggagcggaagcagatgatcgaagcgctggacaagctccgtgaagagcttgagaaa
gtatccgagagggagacgaaataa

DBGET integrated database retrieval system