KEGG   Granulicella mallensis: AciX8_2759Help
Entry
AciX8_2759        CDS       T01664                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
gma  Granulicella mallensis
Pathway
gma00480  Glutathione metabolism
gma00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AciX8_2759
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AciX8_2759
Enzymes [BR:gma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AciX8_2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AEU37069
UniProt: G8NNW5
Position
3389727..3390287
Genome map
AA seq 186 aa AA seqDB search
MPTLYDLPLTTLSGSPTTLADFSGKALLIVNVASRCGLTPQYTDLETLYQQFKDKGFVIL
GFPANDFAGQEPGSNQEIAKFCSTDYPVTFPVFAKIAVTGPEQHPLYAELTSAAPEHVVN
DAGFRGNISGYLKSQGLPEPAPLPAVLWNFEKFVVGRDGTVIARFAPDMLPSDPRIVSAI
EQALSN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgccgactctctacgacctcccgctcacgaccctctccggctcccccaccaccctcgcc
gacttctccggcaaggccctgctgatcgtcaacgtcgcctcccgctgcggacttaccccc
cagtacaccgatctcgaaaccctctatcagcagttcaaggacaaggggttcgtaatcctc
ggcttccccgccaacgacttcgcaggccaggaacccggctccaatcaggagatcgccaag
ttctgctcaactgactatcccgtcaccttccccgtgttcgccaagatcgccgtcaccggc
ccggaacagcacccgctctacgccgagctcacctcggccgcgcccgagcatgtcgtcaac
gacgcaggcttccgcggcaacatctccggctacctcaagtcccagggcctccccgagccc
gcaccgctccccgccgtcctctggaacttcgaaaagtttgtcgtaggccgtgacggcacc
gtcatcgcccgctttgcccccgacatgctccccagcgatccccgcatcgtcagcgcaatc
gaacaagccctgtccaattag

DBGET integrated database retrieval system