KEGG   Granulicella mallensis: AciX8_2875
Entry
AciX8_2875        CDS       T01664                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
gma  Granulicella mallensis
Pathway
gma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:gma00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AciX8_2875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gma02044]
    AciX8_2875
Secretion system [BR:gma02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AciX8_2875
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEU37178
UniProt: G8NPT9
Position
complement(3546955..3547446)
AA seq 163 aa
MPYAGELDYYLNIPGCQGESQTSGATNQIKVNSFSFGGNSVSSVDATSGSSSGKVICGDL
NLDLVMDKGGPLLFQGMTKGTHFATATLTGLKTAGSSPGTYFTLALTEAYVSSTQFSGQS
SMPNLGISLSYNQITITYYMQSATGTLTSTGSVSYSRTTQVSS
NT seq 492 nt   +upstreamnt  +downstreamnt
atgccatatgcaggcgaacttgattactacctcaatattccaggttgccagggtgagtcc
cagacctcgggtgctaccaaccagatcaaggtgaatagtttcagcttcggcggcaactcc
gtgagcagcgtggatgcaacctcgggttcgtcgtcggggaaggtaatctgcggcgatctc
aatctcgatctggtgatggataagggcggcccactgctttttcagggaatgacaaagggt
acccacttcgctacggctacgctgaccggattgaagacggccggctcttctcctggaact
tactttactctcgcgttgacagaggcttatgtgtccagcacgcagttcagtggccagtct
tccatgcccaatttgggcatctccctgtcctataaccaaatcaccatcacgtactacatg
cagtcggcgacaggcactctcacctcgacgggttctgtttcttattcgcgtacgacacag
gtaagcagctag

DBGET integrated database retrieval system