KEGG   Granulicella mallensis: AciX8_2882Help
Entry
AciX8_2882        CDS       T01664                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
gma  Granulicella mallensis
Pathway
gma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:gma00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AciX8_2882
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gma02044]
    AciX8_2882
Secretion system [BR:gma02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AciX8_2882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: AEU37185
UniProt: G8NPU6
Position
3554706..3555497
Genome map
AA seq 263 aa AA seqDB search
MAVSSPSAAAPPARPAAAAHTIASLFSEVLTAILRIRYGKQTIGDTHSFREHMRRLLQTA
MQEARSLGYSSEHIQMAVLATVGFLDESVLNLASAAPADWARRPMQEELFGGHVAGETFF
QNFAALLREENSTKVADVLELHCHCLMLGYKGRYAFGNAGELAQLLRAAQEKIVRARGGA
GTLLPGPATLPQPAATGRDRWSYRLMIAAMVLAAVVILCFVIYSLSLKVGAAGLAQNKMM
PGPVLQHGTLQVPATDVRPEWRG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcagttagttcaccttcggcggctgcaccacctgctcgacctgctgcggcagcacac
acgatcgcctctctcttcagcgaagtcttgaccgcaattctccgcattcgctatggcaaa
cagaccattggcgacacgcattcctttcgcgagcacatgcgcagactgctgcagaccgcc
atgcaggaagctcgtagtctggggtattcgagcgaacatatccagatggcagtgctagcc
accgtcggctttcttgatgagagcgtgctgaaccttgccagcgcggctcccgcggattgg
gcccgacgccctatgcaggaagagcttttcggtggacacgtcgcaggcgagaccttcttc
caaaacttcgctgccctgctgcgcgaagaaaacagcacgaaggtagccgatgtgctggag
ctgcactgtcactgcctgatgcttggctacaagggacgctatgccttcgggaacgcgggt
gaacttgcgcagttgctgcgcgccgcacaggagaagatcgttcgcgctcgtggaggagca
ggcactttgctgccaggccctgccacgctgccgcagcccgctgccacaggacgcgatcgg
tggagctaccgcctgatgatcgcggcgatggtgctggcagcagtggtaatactctgcttc
gtgatctacagcctgtctctaaaggtgggtgcagcaggactcgcgcaaaacaaaatgatg
ccaggccccgtgttacagcatggaaccctgcaagttccagcgacagatgtgcggcccgag
tggcgaggatag

DBGET integrated database retrieval system