KEGG   Granulicella mallensis: AciX8_3346Help
Entry
AciX8_3346        CDS       T01664                                 

Definition
(GenBank) CDP-glucose 4,6-dehydratase
  KO
K01709  CDP-glucose 4,6-dehydratase [EC:4.2.1.45]
Organism
gma  Granulicella mallensis
Pathway
gma00520  Amino sugar and nucleotide sugar metabolism
gma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AciX8_3346
Enzymes [BR:gma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.45  CDP-glucose 4,6-dehydratase
     AciX8_3346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AEU37644
UniProt: G8NUV4
Position
4214556..4215629
Genome map
AA seq 357 aa AA seqDB search
MNLWQGKRVFLTGHTGFKGGWLALWLASKGAIVRGYALDPSTEPNLFTAAKIGSVIEDIR
GDIRDSSKLEPALRDFAPEVVFHLAAQPLVRYSYEDPIGTYETNVIGTARVLDAVRRTPS
VRAVVSVTTDKCYENKEWLWGYRETDPLGGYDPYSSSKACAEIVSAAYRQSYFPVSKLAE
HQCALATGRAGNVIGGGDWSLDRLIPDLVRGFLAGEPVLIRRPHAIRPWQHVLEPLLGYI
LLAEHLLTHDPRYATAFNFGPSDDDAQEVGWIVERMTQFWGGNASWKLDEDPGVHEAGYL
KLDASRARAELAWHPRLRLETTLHWLVDWYKAWQSGEDMHRFTLDQISAYEKLNPAR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacctctggcaaggcaagcgcgtcttcctcaccggccacaccggcttcaaaggcgga
tggctggccctctggctcgcctccaagggcgccatcgtacgcggctacgcgctcgacccc
agcaccgagcccaacctcttcacggcagccaagatcggcagcgtgatcgaagacattcgc
ggcgacattcgcgattcatcgaagcttgaaccagccctgcgcgacttcgctcccgaggtc
gtcttccacctcgccgcgcagccgctcgtgcgctacagctacgaagaccccatcggcaca
tacgagaccaacgtcatcggcacggcacgcgtgctcgacgccgtacgccgcacgcccagc
gttcgcgccgtcgtcagtgtcaccaccgacaagtgctacgagaacaaggagtggctctgg
ggctatcgcgagaccgatcccctcggcggctacgacccctactccagctccaaggcctgc
gccgagatcgtctccgcggcctatcgccagagctacttccctgtcagcaaacttgccgag
caccagtgcgccctcgccaccggtcgtgccggcaacgtgatcggcggaggcgactggtcg
ctcgaccgcctcatccccgatctcgttcgcggcttcctggctggtgagcccgtactcatc
cgccgtccgcacgcaatccgtccgtggcagcacgtgctggagcccctgctgggttacatc
ctgctcgccgagcacctgctgacccacgatccccgctacgccaccgcgttcaacttcggc
ccctccgacgacgatgcgcaggaggtcggctggatcgtcgagcgcatgacacagttctgg
ggcggcaacgccagctggaagctcgacgaggaccccggcgtccacgaggccggttacctg
aagctcgacgccagccgcgcccgcgcagagctcgcctggcaccctcgcctgcggctcgaa
accacgctgcactggctggtcgactggtacaaggcctggcagtcaggcgaagacatgcac
cgcttcaccctcgatcagatctcggcgtacgagaaattgaacccagcccgctaa

DBGET integrated database retrieval system