KEGG   Granulicella mallensis: AciX8_4181
Entry
AciX8_4181        CDS       T01664                                 

Definition
(GenBank) hypothetical protein
Organism
gma  Granulicella mallensis
SSDB
Motif
Pfam: TssC PSDC
Other DBs
NCBI-ProteinID: AEU38460
UniProt: G8NRL9
Position
5333731..5335071
AA seq 446 aa
MAETTTLNRTTEQILGNSPARELLQDIFADLHPGLTNEKRDLASIFSAQSAKEFLGQLTN
FEQLISADDSYEQTVKKLQGQIDSAEGIRDQLLSQIFDQIRTLELSYRQIQLFFENSKVG
DGKIRKPVELFILNADPKAMQDIFSMNIAALEHFIVQRNDNFNFRDDICNLVIPGYYPQP
IREKFEQIANAWGMLLIGDLDDETSFKNVERNFLPGGKYEFLKRPEDQAASDVCLMGYLQ
LRAPHWFEKDSDASEGLYSPPSMVFAGAVARADDAQGMAQGPVGSRFGRVHGAAKARIEP
LIGQMEHLSMERQLIPIIRDADNHLCFYGCRTQADDPYGVLKFFTSYRILRYLERCCRHY
LLQVAGQVLTRDFMDQQIETPLKRLLDEQVEQGTILGYDLFVDKDSNKRMQGICDITLNV
MPTGPAETFVLKIDVPEFSRPEPAKN
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggctgagaccacgacattgaaccgcaccaccgagcagatcctgggcaacagccccgca
cgtgagttgcttcaggacatcttcgccgatcttcatcccggcctgaccaacgaaaagcgc
gacctggccagcatcttctccgcccagtcggccaaggagttcctcggccagctcacgaac
ttcgagcaactgatcagcgccgacgacagctacgagcagaccgtcaagaagctgcagggc
cagatcgacagcgccgaaggcatccgcgatcaactcctgtcgcagatcttcgaccagatc
cgcacgctggaactctcgtaccgccagatccagctcttctttgagaactccaaggtgggc
gacggcaagattcgcaagcccgtcgagctcttcatcctcaacgccgacccgaaggcgatg
caggatatcttctccatgaatatcgccgcgctggagcacttcatcgtgcagcgcaacgat
aacttcaacttccgcgacgacatctgcaacctggtgattccgggttattatccgcagcct
atccgcgagaagttcgaacagatcgccaatgcctggggcatgctcctgatcggcgacctg
gacgatgagacctccttcaagaacgtcgagcgtaacttcctgcccggcggcaagtatgag
ttcctgaagcggcccgaagaccaggctgcctcggacgtctgtctgatgggttatctgcag
ttgcgcgcccctcactggttcgaaaaggacagtgacgccagcgaagggctctacagccct
ccgtcgatggtctttgcaggtgcggttgcacgcgcggacgatgcgcagggcatggcgcag
ggtccggtcggctcccgcttcggccgggtccatggcgcggccaaagctcgcatcgagccg
ctcatcggccagatggagcacctctccatggaacgccagctgatcccgatcattcgcgat
gcggacaaccacctctgcttctacggttgccgtacgcaggccgacgatccgtacggcgtg
ctcaagttctttacctcctaccgcatcctgcggtacctggaacgctgctgccgccactac
ctgctgcaggtcgcgggccaagtgctgacgcgcgacttcatggaccagcagatcgagact
cctctgaagcgtctgctggacgagcaggtagagcagggcacgattctgggctatgacctg
ttcgtcgacaaggattccaacaaacgcatgcagggcatctgcgacatcacgctgaacgtg
atgcctaccggacctgctgaaaccttcgtgctcaagatcgatgtaccggagttcagccgc
ccggaacccgcaaagaactag

DBGET integrated database retrieval system