KEGG   Granulicella mallensis: AciX8_4188
Entry
AciX8_4188        CDS       T01664                                 

Definition
(GenBank) hypothetical protein
Organism
gma  Granulicella mallensis
SSDB
Motif
Pfam: T6SS_VasE Sigma70_r4
Other DBs
NCBI-ProteinID: AEU38467
UniProt: G8NRM6
Position
5339732..5341531
AA seq 599 aa
MNESRPETRNLLNLRSVNWEHGMLLTPDHFLRQEQYLESLSAWGLRYLAAANGLVGGGVR
IPESDLGTVRFDPEVTLNESAEHLDISVSRARGITPSGAIVDIETAGSISNRFSKDHLAG
VAESVVYVVLDPLVRIKSNGVIDSFNPQMRTERIPSYRIALNVTAAERANGLAVGRIRRP
ATGMYFEADPGFIPACISVAGHSELMTGSRRILDAINRLASGYAELHRAMREFMVIFTER
GLETEVDRDSMAFAERMVLELQDTAYALLDRTQTPENFFGRVRRMLHSAAIFFDLATGMQ
QYYDMLRETGESELLGLIELQKHTLQLGRSLRLDEDLGLEVRKMLQSLAGLEKLERALEG
KYIDFRKSASLESTNFIFDRGGKALYKLAARPSRVQGVADEMTIIFSNLRLEGRDRYRLI
LVGDRATPWLRGTSIGAEIRLNEGSGFRRESLILTGDVKFDEQNNIELDFEAPDVPTITD
LRVTVPAYHTVHTALLFLRHRFYASRQDNLEARTVERESERTGILPRPENVSTYAAKSTR
TEIPAPVAQRPMTQPIERMESTTPATPAPVIQPPWMPRDNPANGAEEDASNRPRRRRLE
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgaacgaatcgcggccagaaacgcgcaatctgttgaacctgcggtcggtgaactgggag
catggcatgcttctgacgcccgatcattttctgcgacaggagcagtatctcgagtcgctt
tcggcgtggggcctgcgctatctcgccgcggccaacggcctggtgggcggcggcgtgcgg
attcccgagagcgatctcggcaccgtccgcttcgatcccgaagtgacgctcaatgagtcg
gcggagcacctcgacatctccgtgtcgcgtgcgcgcggcattacgccctccggcgccatc
gtcgacatcgaaaccgcgggcagcatttcgaaccgcttctcgaaggaccacctcgcgggc
gtcgccgagtccgtggtctacgtcgtcctcgatccgctggttcgcatcaagagcaacggc
gtcatcgactctttcaatccgcagatgcgcaccgagcgcatccccagctaccgcatcgcg
ctcaatgtcacggcagcggaacgagctaacggcctagccgtaggccgcattcgccgtcct
gccacaggcatgtacttcgaggcagacccaggctttattcccgcgtgcatctcggtcgcc
ggacactccgagttgatgacgggcagccgccgcatcctggacgccatcaatcgcctcgcc
tcgggctatgcggagctgcatcgcgccatgcgcgagttcatggtcatcttcaccgagcgc
ggtctcgagacggaagtcgaccgcgactcgatggcgtttgccgaacgcatggtgctcgaa
ctgcaggacaccgcgtacgcgctgctcgatcgcactcaaacccctgagaacttcttcggt
cgcgtgcgccggatgctgcactccgccgccatcttcttcgatctcgcgaccggcatgcag
cagtactacgacatgctgcgcgagacgggcgaaagcgaactgctcggcctgatcgagctt
cagaagcatacgttgcaactgggccgcagcctgcggctcgacgaggacctcgggctggag
gtgcgcaagatgcttcagtcgctcgccgggctggagaagctcgagcgcgcgctcgaaggc
aagtacatcgacttccgcaagagcgcctcgctcgagagcaccaacttcatcttcgaccgc
ggcggcaaggcgctgtacaagctggcggcgcgaccgtcccgcgtgcagggcgttgcggac
gagatgaccatcatcttctcgaacctgcggctcgaaggccgcgaccgctaccggctcatc
ctggtcggcgaccgcgccacaccgtggcttcgcggcacgtcgatcggcgcggagatccgg
ctgaatgagggctcgggcttccgccgcgagagcctcatcctcaccggcgacgtaaagttc
gacgagcagaacaacatcgagctcgacttcgaagcgcccgacgttcccacaatcaccgac
ctgcgcgtcacggtgcccgcgtatcacaccgtgcacaccgcgctgctcttcctgcgccac
cgcttctatgccagccgccaggacaacctggaggcgcgtaccgtcgagcgcgaatcggaa
cgcaccggcatcctgccgcgcccggagaacgtctccacgtacgccgcaaagagcacgcgt
accgagattcccgcgccagtagcgcaacggcctatgacgcagccgatcgagcgcatggag
agcacgacaccagccacgccggcacccgtcatccagccgccgtggatgcctcgcgataac
cctgcgaatggagctgaggaagacgcctccaaccgcccacgacgccgccgtctggaataa

DBGET integrated database retrieval system