KEGG   Granulicella mallensis: AciX8_4811Help
Entry
AciX8_4811        CDS       T01664                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
gma  Granulicella mallensis
Pathway
gma00010  Glycolysis / Gluconeogenesis
gma00052  Galactose metabolism
gma01100  Metabolic pathways
gma01110  Biosynthesis of secondary metabolites
gma01120  Microbial metabolism in diverse environments
gma01130  Biosynthesis of antibiotics
Module
gma_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX8_4811
   00052 Galactose metabolism
    AciX8_4811
Enzymes [BR:gma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AciX8_4811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEU39080
UniProt: G8NYM1
Position
6117619..6118665
Genome map
AA seq 348 aa AA seqDB search
MSSITQVQSIAWGTTPQGEPVHLFTLRNAQVEASIATYGARLTSVRTHDRKGTMGEISLG
ADELAPYLTNKSYIGATIGRLGNRLANGRFTLDGTGYQIPLNNGPNALHGGPVGFDRKVW
TAQEVPDGVEMSYVSPDGEMGFPGTLHVTVRYTLTDNSLRLDYEASCDKPTIVNLTNHAY
WNLTGDMGDLSHHLLKLNSESFTPINSTLIPTGELRPVENTPLDFRTPKEIGLQWDSEDE
QVQLAGGYDHNHVLASAEEPLRLAAEVTEPVSGRTMQVLTTEPGVQFYSGNFLDGSFQGR
GGSIYKRRSGFCLETQHFPDSPNHPEFPSVRIEPNAPLRSTTIHRFSA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatcacacaggtccaatccatcgcctggggcacgacgccccagggagagccc
gttcatctcttcacccttcgtaatgcgcaggtagaagccagcatcgccacctatggcgca
cggctcacctcggtgcgcacgcacgaccgcaagggcacgatgggcgagatttcgctcggc
gcggatgagctggcgccctacctcaccaataagtcctacattggcgcgaccatcggccgg
ctcggcaaccgccttgcgaacggccggttcacactcgatggaacgggatatcagatcccg
ctcaacaacggccccaatgcgctgcacggcgggcctgtcggcttcgaccgcaaggtgtgg
acggcgcaggaagtccctgacggcgtggagatgtcctatgtctcccccgatggcgagatg
ggctttcccggcacgctccatgtgacggtgcgctatacgctgacggacaacagcctccgc
ctggactacgaagcttcctgcgacaagccgaccatcgtgaacctgacgaaccatgcctac
tggaacctgaccggagacatgggcgacctgtcgcaccatctgttgaagctgaactccgag
agcttcactccgattaacagcacgctgattcccaccggcgagcttcgcccggttgaaaac
acgccgctcgacttccgcactccgaaagagatcggcctgcagtgggacagcgaggacgaa
caggtgcagcttgcgggcggatacgaccataaccacgtgctggcaagtgctgaagagccc
ctgaggctcgcggcggaggtaaccgagccagtctcaggcaggacgatgcaggtgctcaca
acggagcccggcgtgcagttctactccggcaacttcctcgatggatcgttccagggtaga
ggcggcagtatctacaagaggcgctccggtttctgcctcgaaacccagcactttccggat
tcgccgaaccatccggagttcccctccgtacggatcgagccgaatgcgccgctgcggagt
acgaccattcatcgtttctcggcataa

DBGET integrated database retrieval system