KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0042Help
Entry
GY4MC1_0042       CDS       T01348                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00900  Terpenoid backbone biosynthesis
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GY4MC1_0042
Enzymes [BR:gmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GY4MC1_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADP72898
UniProt: A0A0F6BHJ7
Position
53174..54043
Genome map
AA seq 289 aa AA seqDB search
MKVLVKAPAKINLSLDVLHKRPDGYHEVKMVMTTIDLADRIELIPRTDDVIQIISQNRFV
PDDHRNLAYQAAKVLKDTFGIKQGVAISITKNIPVAAGLAGGSSDAAATLRGLNKLWRLG
LTLDELAELGAQIGSDVPFCVYGGTAVATGRGEKIMPISSPPPCWVILAKPSIGVSTAEV
YRNLKVGEIQHPDVDGMVEAIERQDYAAICQLVGNVLEEVTLKMHPEVAHIKEQMKRFGA
DAVLMSGSGPTVFGLVQHDSRLQRIYNGLRGFCDQVFAVRILGEQNSLD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtattagtcaaggcaccggctaaaatcaatttatcgttggacgtattgcataaa
cggcctgacggatatcatgaagtaaagatggtaatgacaacgattgatctggcggatcgc
atcgaactaattccgcggaccgatgatgtgatacaaattatttcgcaaaaccgcttcgtt
ccggatgaccaccgcaatctggcgtatcaggctgcaaaagtattgaaagatacatttggt
atcaaacaaggggtggcgatttccattacaaaaaatattccagtagcggcagggctggcc
gggggaagcagcgatgctgcagcgacgctccgcggcttaaacaagctttggcgtttaggg
cttacacttgatgaattggcggagctaggtgcgcaaatcggttctgacgtcccgttttgc
gtttatggcggaactgcggttgcaacagggcgcggcgaaaaaattatgccgatttcttcc
ccgccgccatgctgggttattttagcaaagccatcgatcggcgtttcgactgccgaagta
taccggaatttaaaggttggcgagattcagcacccggatgtggatgggatggtggaggcg
attgaacgccaagattatgcggctatttgccaattagtcggaaacgtattagaagaagtg
acattgaaaatgcatccggaagtggcgcacattaaagagcaaatgaagcggtttggcgcg
gatgcggtattgatgagcggcagcgggccgacggtgtttggactcgttcagcatgattcc
aggctgcaacgaatttataatggactgcgcgggttttgcgatcaagtgttcgctgtccgg
atattaggtgaacaaaattcacttgattaa

DBGET integrated database retrieval system