KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0416Help
Entry
GY4MC1_0416       CDS       T01348                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00010  Glycolysis / Gluconeogenesis
gmc00051  Fructose and mannose metabolism
gmc00562  Inositol phosphate metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01200  Carbon metabolism
gmc01230  Biosynthesis of amino acids
Module
gmc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gmc_M00002  Glycolysis, core module involving three-carbon compounds
gmc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_0416
   00051 Fructose and mannose metabolism
    GY4MC1_0416
   00562 Inositol phosphate metabolism
    GY4MC1_0416
Enzymes [BR:gmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GY4MC1_0416
Exosome [BR:gmc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GY4MC1_0416
  Exosomal proteins of bladder cancer cells
   GY4MC1_0416
  Exosomal proteins of melanoma cells
   GY4MC1_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADP73257
UniProt: A0A0F6BIK6
Position
452233..452994
Genome map
AA seq 253 aa AA seqDB search
MRKRIIAGNWKMHKTLPEAVSFVEEVKRLVPPAEQVDSVICAPFLFLDRLVQNVQGSDLK
IGAQNMHFEDKGAFTGEISPVALKDIGVAYVIIGHSERREMFAETDETVNKKVHAAFKHG
LIPIVCCGETLEQRESGKTNDIVGAQVEKALAGLTAEQAKQVVIAYEPIWAIGTGKSSTA
EDANEVCGHIRSVIAKIFSPEVAEAVRIQYGGSVKPENIREFLAQEHIDGALVGGASLDP
KSFLQLVEAGQHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacgaattatcgcaggaaactggaaaatgcataaaacattgccggaggcagta
agcttcgtggaagaagttaaacggcttgtgccgccggcagaacaagttgactctgtcatt
tgcgcccctttcttgtttttagaccgtcttgtccaaaatgtacaaggctctgatttaaaa
atcggtgcgcaaaacatgcattttgaagacaaaggggcgtttactggcgaaatcagcccg
gttgcgctgaaagatatcggcgtggcgtatgtcattatcggccactccgagcgccgcgaa
atgtttgcggagacggatgaaaccgtcaataaaaaagtgcatgctgcctttaagcatggg
ctgattccgatcgtctgctgcggcgaaacgctggaacagcgggaaagcggcaaaacaaat
gacatcgtcggcgcgcaagttgaaaaagcgcttgccggtttaactgcggagcaagcgaaa
caagtggtgatcgcctatgagccgatttgggcgattggcactggcaaatcatcgacggca
gaagatgccaacgaagtgtgcggccatattcgttcggtcatcgctaaaatcttttctccg
gaagtggctgaagccgtgcgcattcagtatggcggcagcgtcaaaccggaaaacatccgc
gaatttttagcgcaagaacatattgatggcgcccttgtcggcggcgcaagcctcgatccg
aaatcatttttacaattagtggaggctggacagcatgagtaa

DBGET integrated database retrieval system