KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0549Help
Entry
GY4MC1_0549       CDS       T01348                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    GY4MC1_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADP73381
UniProt: A0A0F6BIY0
Position
578045..579043
Genome map
AA seq 332 aa AA seqDB search
MDTVFLLTVLIVVFALAFDFINGFHDTANAIATSVSTRALSPRKAIVLAATMNFIGALTF
TGVAKTITKDIVDPFALENGSVVILAALTAAIAWNLITWYYGIPSSSSHALIGSIAGAAV
SAAGFDVLHYQGFLKILESLIISPFLALAVGFVIMSLFRAIFKNANLTRTTKGFRMFQVI
TAAFQAYTHGTNDAQKTMGIITMALIAANYHTSSEVPEWVRISAAIAMGLGTSVGGWKII
KTVGGKIMKIRPVNGAAADLSSALVIFSATLLHLPVSTTHVISSSIMGVGAAQRVKGVKW
GVAQRIVLTWIITLPVSALIAGFVYQIFKLFF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatacagtatttttacttacggttcttattgtcgtttttgcattggcgtttgatttt
attaacgggtttcatgataccgccaatgccattgcaacatctgtctcaacgcgagcattg
tcgccgcggaaagcgattgttttagcggcaaccatgaactttattggcgcattgacgttt
actggcgttgcgaaaacgatcacgaaagacattgtcgacccattcgcgcttgagaacggt
tcggttgtcattttagcggcattgacggcggcgattgcatggaatttaattacgtggtat
tacggaatcccgagcagttcttcgcatgcgttgatcggttcgattgcgggcgccgctgtt
tcggcggcgggatttgatgttttgcattatcaaggctttttaaaaattttagaatccctt
attatctcgccgtttctcgctttagcagtcgggtttgtcatcatgagcttgtttcgtgcc
atttttaaaaacgccaacttgacgcggacaacgaaagggttccgcatgtttcaagtcatc
accgctgcttttcaagcgtatacgcacggaaccaacgatgcgcaaaagacgatgggaatt
atcacgatggcgcttattgctgcgaactatcatacgtcaagtgaagtgccggaatgggtg
cgaatttctgctgccattgcgatgggattgggcacatctgttggcggatggaaaattata
aaaaccgttggcggcaaaattatgaaaatacgtcctgttaacggggcggctgccgattta
tcatcggcactcgtcattttctccgccactctccttcatttgccggtcagcacgactcat
gttatctcttcatcgattatgggagtcggagcggcacagcgcgttaaaggcgtcaaatgg
ggtgtggcgcagcgcattgtgttaacatggattattacattgccggtttctgcacttatt
gctggatttgtctatcaaatttttaaattatttttttga

DBGET integrated database retrieval system