KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1295Help
Entry
GY4MC1_1295       CDS       T01348                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00860  Porphyrin and chlorophyll metabolism
gmc01100  Metabolic pathways
Module
gmc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GY4MC1_1295
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     GY4MC1_1295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Oxidored_molyb
Motif
Other DBs
NCBI-ProteinID: ADP74099
UniProt: A0A0F6BKZ8
Position
1276298..1277014
Genome map
AA seq 238 aa AA seqDB search
MADSLAITLIRHGMTPENQARRYIGHTDVPLDEQEKTRLLQADLPLFKPVDLLVSSDLLR
CKQTRELLFRNYGGGKYEMVQWREMHFGDWEGKTFLELKEIKEYRQWLSSPLAMVPPNGE
SYQAFCQRVEEALEQTVLLAEQANAEHVAVVTHGGPIRCILERYAPQERPFWEWTVPFGG
GFTLQSTLERWKEKKRCISLSEVLFKESENGRALTTELKDGKMLFGVTDMSGNMASRM
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggctgatagtttggctattacgctaatccgtcacgggatgacgccggaaaatcaagca
aggcgatacatcgggcatacggatgtgccgcttgacgaacaggaaaaaacgcggcttctc
caagcagacttgccgctttttaagcctgtcgatttgctggtgtcgagcgatttgctccgc
tgtaagcagacgcgcgagcttttatttagaaactatggcggtggcaaatacgaaatggtg
cagtggcgggaaatgcattttggcgattgggaaggaaaaacgtttttagagttgaaagaa
ataaaagaataccggcaatggctgagttcaccgctggcgatggtgccgccaaacggagaa
agctaccaagctttttgccagcgggtggaagaagcgcttgaacaaacggtgctgctggct
gagcaagcaaatgccgagcatgtcgccgtcgtcacgcatggcggcccgattcgctgcata
ttggagcgctatgctccgcaagagcgaccgttttgggaatggaccgtgccgtttggcggc
ggatttaccttgcaatcaacgctcgagaggtggaaggagaaaaaacgatgcatttcattg
tcggaggtgcttttcaaggaaagcgaaaatgggcgcgcgcttactaccgagttgaaggac
ggaaagatgttgtttggtgtaacggatatgagcgggaatatggcgagccggatgtga

DBGET integrated database retrieval system