KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2278Help
Entry
GY4MC1_2278       CDS       T01348                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00010  Glycolysis / Gluconeogenesis
gmc00020  Citrate cycle (TCA cycle)
gmc00620  Pyruvate metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01200  Carbon metabolism
Module
gmc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_2278
   00020 Citrate cycle (TCA cycle)
    GY4MC1_2278
   00620 Pyruvate metabolism
    GY4MC1_2278
Enzymes [BR:gmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GY4MC1_2278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 NQRA RnfC_N GCV_H HlyD_3 YqfD DUF2118
Motif
Other DBs
NCBI-ProteinID: ADP75009
UniProt: A0A0F6BNK8
Position
complement(2261951..2263324)
Genome map
AA seq 457 aa AA seqDB search
MLMEVKLPRLSDTYDESLITFWHVSEGDAVEKGDTLVEVQTEKAVSEIEAPESGIVKEIR
KKRGETAAVGEVLAVIETAAETADSPEEQEKTEQEIPEETAVQAQEIPVEKKATPRVKKL
AKELGVDWRLVTPTGPDGKVTEEDVRNAAKQSEHEKQPSRFVKAAPSVRKFAREHHVNLD
EVTPTGPNGRILKSDVEAVIAKRKLAQTEAEQKAAAAKETTRDITQSQRRIPLTGIRKAI
ANAMVHSKSAIPHVTHFDEANVTKLVSHRQSVKPFADEEGIKLTYLAYAVKALTAVLKKY
PMLNASLDEEREEIILKDEYHIGFAADTDRGLVVPVIKHADQKSLFQIAKEIQELADKAR
NGSIKADEMTGSTCTISNIGSANGSWFTPIIHYPESCILGIGRVEKKPVVVDDSLEIAPM
MALSLSYDHRLIDGVLAQKALNELKKYLSEPDLLFVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgttaatggaagtgaaattgccccgactatccgatacgtatgatgaaagtttaatcacc
ttctggcatgtttcagaaggggatgccgtggaaaaaggcgatacgcttgtggaagtgcag
acggaaaaagccgtttcagaaattgaggcgccggagtcaggcattgtcaaagaaatccgg
aaaaaaagaggcgaaaccgccgcggtcggggaagtattagctgttattgaaacagccgcg
gaaacggcagattccccagaggagcaggagaaaacagagcaggagattcctgaggaaaca
gcagttcaggctcaggaaattccggttgagaaaaaggcgacgccgcgtgtaaaaaaattg
gccaaagaacttggtgtggactggcgccttgtcaccccaaccgggccggatggcaaagtc
acggaagaagatgtccgaaatgcggcaaaacaaagtgaacacgaaaaacagccgagccgg
tttgtcaaagcggcgccatccgtgcgcaaatttgcccgcgaacaccatgtgaaccttgat
gaagtgaccccgaccgggccgaacggaagaatactaaaaagcgatgtcgaagcagtcatc
gccaaacggaaattagcgcaaacagaagcggaacaaaaagcggcagctgccaaagaaaca
acacgggatatcacgcaaagccaacgaagaatcccgcttaccggcattcgaaaagcgata
gcaaacgccatggttcattcgaaatcggcaatcccgcatgtaactcattttgatgaggcg
aatgtaacaaagcttgtctcccatcgccaaagtgtgaaaccgtttgcggatgaagaggga
attaaactcacgtatttagcatatgcggtcaaagcgttaacggcggtgctgaaaaaatac
ccgatgttaaatgcctcgttggatgaggaacgagaggaaattattttaaaggatgaatac
catatcggctttgccgctgatacggatcgcggccttgttgttccggtgatcaaacatgcg
gatcaaaaatcgttatttcaaatcgctaaagaaattcaagagcttgcggacaaagcaaga
aatggttccatcaaagcggatgaaatgacgggatccacgtgtacgatatcaaacatcgga
tcagcgaatggttcttggtttacgccgatcatccactatccagaatcatgtattttaggg
atcggcagagtggagaaaaaacctgttgtcgtcgatgattcgctcgaaatcgccccgatg
atggctttatcgctcagctatgatcaccgcttgatcgacggcgttttagcgcaaaaagcg
ttaaatgaattgaaaaaatatttaagcgaaccggatttgttatttgtcatataa

DBGET integrated database retrieval system