KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2949Help
Entry
GY4MC1_2949       CDS       T01348                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00010  Glycolysis / Gluconeogenesis
gmc00053  Ascorbate and aldarate metabolism
gmc00071  Fatty acid degradation
gmc00280  Valine, leucine and isoleucine degradation
gmc00310  Lysine degradation
gmc00330  Arginine and proline metabolism
gmc00340  Histidine metabolism
gmc00380  Tryptophan metabolism
gmc00410  beta-Alanine metabolism
gmc00561  Glycerolipid metabolism
gmc00620  Pyruvate metabolism
gmc00625  Chloroalkane and chloroalkene degradation
gmc00903  Limonene and pinene degradation
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_2949
   00053 Ascorbate and aldarate metabolism
    GY4MC1_2949
   00620 Pyruvate metabolism
    GY4MC1_2949
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GY4MC1_2949
   00561 Glycerolipid metabolism
    GY4MC1_2949
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GY4MC1_2949
   00310 Lysine degradation
    GY4MC1_2949
   00330 Arginine and proline metabolism
    GY4MC1_2949
   00340 Histidine metabolism
    GY4MC1_2949
   00380 Tryptophan metabolism
    GY4MC1_2949
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GY4MC1_2949
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GY4MC1_2949
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GY4MC1_2949
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     GY4MC1_2949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh N1221 DUF2229
Motif
Other DBs
NCBI-ProteinID: ADP75639
UniProt: A0A0F6BQD8
Position
2939636..2941096
Genome map
AA seq 486 aa AA seqDB search
MKQFLELNKSFINGEWVEGASANSYDILNPYDDSVITTVKLATKEQTQKAFEAAYQAQKK
WAKTPVEERKAIIRKALEYFKENKEAILEALAVESGSTYVKAEIEYQSTLAELAEAEKMT
EEIYAYREVPSPIEGKTNRIYRLPLGVISSISPFNFPLFLSIRTIAPAIALGNAVVHKPD
LKTGLTGGSIIAAAFEYAGLPKGVFNVVLTSSREIGDEMLTNPHSKMVSFTGSTEVGKRV
GAVAGGALKRVALELGGNSPFVVLSDADVDRAVEAAIFGKYLHQGQICMIVNRFIIHQDV
YDEFVNKFVERAKKLPYGDPRNRENVIGPIINQRQLEKALKIIEEAKAEGIPLALEGKRV
GNILTPTVFVNVDNNSKLAQTEVFAPIAIMIKAETDEQAIELANGTEYGLSSAIFTSDLE
KGTKLALEIDSGMIHVNDQTVNLQSDTPFGGTKASGLGRFGNPWIVEEFTETKWVSVQHQ
YRKFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacagtttcttgaacttaataaaagctttattaatggcgaatgggtggaaggagcc
agtgcaaattcttatgatattttaaatccatacgatgattctgtcatcacaaccgttaaa
ttggctacaaaagaacaaacgcagaaagcgtttgaagcggcataccaagcacagaaaaaa
tgggcaaaaacgccagtggaagaaagaaaagctatcatccggaaagcattagaatatttt
aaagagaacaaagaagcaattttagaggctttggctgtagaatcaggcagcacgtatgtc
aaagcagaaatagaatatcaaagcacgttagcggaattggcagaagcagaaaaaatgaca
gaagagatttatgcgtacagggaagttccttctcctattgaaggaaaaaccaatcgaatt
taccgattgccgctgggagtgatttcatcgatttctccgtttaatttcccattgttttta
tctatcagaaccattgctcctgcgattgccttagggaatgctgtggtccataagccagac
ttgaaaaccggcttaactggaggttcgattattgcagcggcatttgaatatgcaggattg
cctaaaggggtattcaatgtcgttttgacgtcttcgcgggaaatcggtgacgaaatgtta
acaaatcctcattcaaaaatggttagtttcaccggatccacagaggtaggaaaacgtgtt
ggcgctgttgccggcggcgcgctaaaacgcgtagcattagaattaggcggaaacagcccg
tttgtcgtgttgagcgatgctgatgttgaccgagcagtggaagcagcgatattcgggaaa
tatttgcatcaagggcaaatttgcatgatcgtgaatcgatttattattcatcaagatgta
tatgatgaatttgtgaacaaatttgtggaacgggcgaaaaaattgccatatggagatccg
cgcaaccgtgaaaacgtgattgggccaatcatcaaccaacgccagttagaaaaagcatta
aaaataattgaagaagcaaaagcggaaggaatcccgttggcattagaaggaaaacgcgta
ggaaacatattaacgccaacggtatttgtgaatgtggataataacagcaagttagcgcaa
acggaagtatttgcgccaattgcgatcatgattaaagcggaaacagatgaacaagcgatt
gaattggcgaatggaaccgaatatggtttaagctcggctatatttacctctgatcttgaa
aaaggaacaaaactagctttagagattgatagcggaatgatacatgttaacgaccaaacg
gtcaaccttcaatcggataccccgtttggaggaacaaaagcaagcggattgggccgcttc
ggaaatccgtggattgtagaagagtttacagaaacaaaatgggtttccgtccaacatcaa
tatcggaaattcccgttttaa

DBGET integrated database retrieval system