KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_3418Help
Entry
GY4MC1_3418       CDS       T01348                                 

Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00020  Citrate cycle (TCA cycle)
gmc00620  Pyruvate metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01200  Carbon metabolism
Module
gmc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gmc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GY4MC1_3418
   00620 Pyruvate metabolism
    GY4MC1_3418
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     GY4MC1_3418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox HI0933_like Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ADP76077
UniProt: A0A0F6BRM6
Position
complement(3399833..3401371)
Genome map
AA seq 512 aa AA seqDB search
MGKMSNRQTRTDVILIGAGIMSATLGTLLKELAPEWEIKVFEQLDKPGEESSNEWNNAGT
GHSALCELNYTPEKPDGSIDISKAIKINEQFQISRQFWAYLVKNNLLQNPQEFIRPLPHM
SLVQGENNVRFLKKRFEALSNNPLFQGMEFSDDPKKLKEWIPLIMEGRTSNEPIAATKID
SGTDVNFGALTRMLFDHLKKKNVEINYKHSVKDIKRTSDGLWELKVKDLNSGSVEIHQAK
FVFIGAGGGSLHLLQKSGIPESKRIGGFPVSGLFMVCNNPEIVEQHHAKVYSKAKIGAPP
MSVPHLDTRYIDNKKMLLFGPFAGFSPKFLKNGSNMDLFTSVKPHNLTTLLAAAFKNFSL
EKYLIQQLMLTKEKRMKELREFIPTAKSEDWDIVVAGQRVQIIKDTETGGKGTIQFGTEV
VSAADGSIAALLGASPGASTAVHVMLEVLKKCFPQHMREWEPKIKEMIPSYGVSLAENPE
LFQELHDATAETLGLNEKKPVSDANEKEPVYN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatgagtaacagacagacaagaacagacgttatcttgattggtgccggaatt
atgagtgcgactttagggacactgttgaaagaattagcgccggaatgggaaattaaagtg
tttgagcagcttgacaaaccaggagaagaaagctctaacgaatggaataatgcgggaacg
gggcattctgcactatgcgagcttaactacacgcccgagaaaccggatggatcgattgat
attagcaaagccataaaaattaacgaacagttccaaatttccagacagttttgggcttac
cttgttaaaaacaacctgttacaaaatccgcaggaatttatcagaccgttgccccacatg
agtttagtccaaggggaaaataatgtgagatttttaaagaaacgttttgaagcactatca
aacaatccattattccaaggaatggaattttctgatgacccgaaaaaactgaaagaatgg
attccgcttatcatggaaggccgtacatcgaatgaaccgatcgcggcaactaaaatcgac
tcaggtacagatgttaactttggcgctttaacgcgcatgttatttgaccacttaaagaag
aaaaatgttgaaataaactacaagcatagtgtgaaagatataaaacgcaccagcgacggc
ctgtgggaattgaaagtgaaggatctcaacagcggttctgttgaaatccatcaagctaaa
ttcgtatttattggagccggcgggggaagcctgcacttgcttcaaaaatctggtattcca
gaaagcaagcgcattggcggattccctgtaagcggattatttatggtatgtaataatcca
gaaattgtcgagcaacatcatgcaaaagtgtacagtaaagctaaaatcggtgcgcctcct
atgtctgttccgcacctagatacacggtatatcgacaacaaaaaaatgttgctctttggc
ccgtttgcaggcttctcgcctaaattcttaaaaaatggttccaatatggatttgtttact
tccgtaaaaccgcacaatctcacgactttgttggcggcagcttttaaaaacttttctttg
gaaaaatacttgatccagcagcttatgttaacgaaagaaaagcgcatgaaagagttgcgc
gagtttatcccgacggctaaatcagaagattgggatatcgttgtcgcgggtcagcgtgtg
caaattatcaaagatacggaaactggcggcaaaggaacgattcaatttggtacggaagtt
gtcagtgctgcagatggctcgatcgctgcattgctcggcgcttctcctggtgcttcaact
gccgtacacgtcatgcttgaggtgttaaaaaaatgcttccctcaacatatgcgtgaatgg
gaaccgaaaattaaagaaatgattccttcttacggcgtgtccctagcggaaaacccagag
cttttccaagaacttcatgatgcaacagcagagacgctcggtttaaacgaaaaaaagccg
gtctctgatgcaaacgaaaaagaaccggtttataattaa

DBGET integrated database retrieval system