KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_3739Help
Entry
GY4MC1_3739       CDS       T01348                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00071  Fatty acid degradation
gmc00072  Synthesis and degradation of ketone bodies
gmc00280  Valine, leucine and isoleucine degradation
gmc00310  Lysine degradation
gmc00362  Benzoate degradation
gmc00380  Tryptophan metabolism
gmc00620  Pyruvate metabolism
gmc00630  Glyoxylate and dicarboxylate metabolism
gmc00640  Propanoate metabolism
gmc00650  Butanoate metabolism
gmc00900  Terpenoid backbone biosynthesis
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01200  Carbon metabolism
gmc01212  Fatty acid metabolism
gmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GY4MC1_3739
   00630 Glyoxylate and dicarboxylate metabolism
    GY4MC1_3739
   00640 Propanoate metabolism
    GY4MC1_3739
   00650 Butanoate metabolism
    GY4MC1_3739
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GY4MC1_3739
   00072 Synthesis and degradation of ketone bodies
    GY4MC1_3739
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GY4MC1_3739
   00310 Lysine degradation
    GY4MC1_3739
   00380 Tryptophan metabolism
    GY4MC1_3739
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GY4MC1_3739
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GY4MC1_3739
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GY4MC1_3739
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gmc04147]
    GY4MC1_3739
Enzymes [BR:gmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GY4MC1_3739
Exosome [BR:gmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GY4MC1_3739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2496
Motif
Other DBs
NCBI-ProteinID: ADP76364
UniProt: A0A0F6BSG3
Position
complement(3734276..3735460)
Genome map
AA seq 394 aa AA seqDB search
MGKTVILSGVRTPFGKFGGALKPLTAAQLGGIAVKEALHRARVSGEQVDQVILGTVLQGG
QGQLPSRQAMRYAGIPWEVRTETVNKVCASGMRSVTLGDQIIRLGDAEVIVAGGMESMSN
APYILPNARWGLRMGDAAVKDLMVYDGLTCSFTGVHMGVYGGETAKELEISREEQDEWAY
RSHQRAIAAMEAGLLAEEIVPVEVPQHKGEPLLVEHDEAPRKDTSLEKLAKLPPVFDPEG
TITAGNAPGVNDGAAALVLMSEERAAREGRKPLATILAHASIAVAAKDFPKTPGFVINEL
LRKTGKTVDDIDLFEINEAFAAVALASIKIAGIDPEKVNVNGGAVALGHPIGASGARIII
TLIHELKRRGGGIGIAAICSGGGQGDAVMVQVDS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaacggtgattttaagtggggttcgcacgccgtttggaaaattcggcggtgcg
ttaaagccgcttacggcggctcagctcggcggcattgctgtgaaagaagcgcttcatcgc
gccagagtcagcggcgagcaggtcgatcaagtcattttaggaacggtgctgcaaggaggg
caaggccagcttccatcccgccaagcgatgcgctatgctggcattccgtgggaagtgcgg
acagaaacggttaataaagtgtgcgcttcgggaatgcggagcgtcacacttggcgatcaa
atcatccgcctgggagatgccgaagtcatcgtcgcgggcggaatggaatcgatgagcaat
gcgccatacattttgccaaatgcgcgttggggattgcgaatgggcgatgcggctgtcaaa
gatttaatggtatatgatggtttaacatgcagttttaccggagttcatatgggggtttac
ggcggcgaaacggcgaaagaattggagatttcccgcgaagaacaggatgagtgggcatac
cgcagccatcagcgggcgattgcggcgatggaagccggattattggcggaggagatcgta
ccagtggaagttccgcagcacaaaggggagccgctgttggtggagcatgacgaagcaccg
agaaaagatacgtctcttgaaaaactggcgaagctgcctcctgtatttgacccggaaggg
acgataacagcgggaaacgctcccggagtcaatgatggcgctgccgcacttgtgctgatg
agtgaagaaagagcggcgcgcgaaggaagaaaaccgctcgcgacgattttggcccatgca
tcgattgccgttgcggcaaaagactttccgaaaacgccggggtttgtgatcaacgagctg
cttcgcaaaacggggaaaacagtcgatgacattgatttatttgaaattaacgaggcgttt
gccgctgtcgcgctcgccagcataaaaatcgccggcatcgatccagaaaaagtgaatgtc
aatggcggcgcggtcgcgttaggccatccgatcggcgcgagcggcgcgcgcattatcatt
acattaattcacgaattaaagcgccgcggcggcggcatcgggatcgcggcgatctgcagc
ggcggcggccaaggcgatgctgttatggtgcaggttgattcgtaa

DBGET integrated database retrieval system