KEGG   Geobacter metallireducens: Gmet_0270Help
Entry
Gmet_0270         CDS       T00295                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase, stereospecific
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
gme  Geobacter metallireducens
Pathway
gme00260  Glycine, serine and threonine metabolism
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
gme01120  Microbial metabolism in diverse environments
gme01130  Biosynthesis of antibiotics
gme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gmet_0270 (ltaA)
Enzymes [BR:gme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Gmet_0270 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABB30515
UniProt: Q39Z09
Position
299885..300904
Genome map
AA seq 339 aa AA seqDB search
MKIIDLRSDTVTRPCPAMRAAMAVAEVGDDVYGEDPTVNRLEALAAGMLGTEAALFVTSG
TQSNLLAIMTHCGRGDEYIAGQTAHCYRFEGGGAAVLGGVQPQPVDVEPDGTLDLVKVAA
AIKPNDPHFARTRLLCLENTQAGRVLPLDYLARARTLARERGLALHLDGARLFNAAVALD
VEAREITDHFESVSVCLSKGLGAPVGSLLCGSRGFVAEARRWRKVLGGGMRQAGVLAAAG
IVALTENVARLAEDHANARRLAEGLAAVGGLDGDSVSVQTNMVFLSLPPDHAEALATFLC
DRGVLISGRERIRLVTHRDVTSADIDRVVGACGEFFRRP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatcgacctgcggagcgataccgtcaccaggccctgcccggccatgcgggcc
gctatggctgtagccgaggtgggtgacgacgtctatggcgaggaccccaccgtgaaccgc
ctcgaagccctggccgccgggatgctcggcaccgaggcggccctcttcgtgacgagcggc
acccagtccaacctccttgccatcatgacccactgcgggcggggtgacgagtacatcgcc
ggccagacggcccactgctaccgtttcgaggggggcggcgccgcggtcctcggcggggtc
cagccccagcccgtggacgtggaacccgacggaacccttgacctcgtgaaagtggccgcg
gccatcaagcccaacgatccccactttgcccggacacggctcctctgtctggagaacacc
caggcggggagggttctccccctcgattacctggctcgcgcccgtacccttgcccgggag
cgtggcctcgccctccacctggacggggcgcggctcttcaatgccgccgtggccctcgac
gtggaagcccgggagataacggatcatttcgaatcggtgtcggtctgtctctccaagggg
ctcggcgcgccggtggggtcgcttttgtgcgggagtcgggggtttgtggccgaggcccga
cgctggcgcaaggtcctcggcggcggcatgcgccaggcaggtgtcctggccgccgcggga
attgtggccctcacggagaacgtggcgcgcctcgccgaggaccacgccaatgcgcggcgt
ctggccgaggggctggctgccgtcggcggtctcgatggtgactccgtctcggttcagacg
aacatggtgttcctctcgcttccccctgatcatgccgaggcactggcaacctttctctgc
gacaggggagttctcatctccggtcgggagcgcatccgccttgtcacccatcgggatgtg
acctctgccgacatcgatcgggtagtgggagcctgcggggagtttttcaggcgaccctga

DBGET integrated database retrieval system